(data stored in ACNUC7421 zone)

EMBL: CP001700.PE344

CP001700.PE344       Location/Qualifiers
FT   CDS_pept        387837..388442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0346"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sco:SCO3900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69299"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE3"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACU69299.1"
FT                   /translation="MAKRSQILELAVLGLLHEHPMHGYELRRQLNVQLGAFRALSYGTL
FT                   YPCLKDLVARGWIAEDDTQTANVAASRRAKISYKLTAEGKERFQELMTTSGSAAWEDDN
FT                   FGVHFAFFGRTNAGVRIRILEGRRSRLEERMEAVRTSLARSRDRLDSYTLELQRHGLES
FT                   TEREVRWLNELIRTEHEQAFPAPPQQQPQQGSPEPRPS"
     gtggcgaagc ggtcccagat cctggaactg gccgtcctcg gcctgctcca cgagcacccg        60
     atgcacggct atgagctgcg ccgccagctc aacgtgcagc tcggcgcctt ccgcgcgctg       120
     tcctacggga cgctgtaccc ctgtctgaag gacctggtcg cccgaggctg gatcgccgag       180
     gacgacaccc agacggccaa cgtcgccgcc tcgcgccgcg ccaagatcag ctacaagctg       240
     accgcggagg gcaaggagcg gttccaggag ctcatgacga cctccggttc ggcggcctgg       300
     gaggacgaca acttcggcgt ccacttcgcg ttcttcggac ggaccaacgc cggcgtccgg       360
     atccgcatcc tcgaagggcg gcgcagccgt ctggaggagc ggatggaggc ggtgcgcacc       420
     tcgctcgccc gcagccgcga ccggctggac tcctacaccc tggagcttca gcggcacggc       480
     ttggagagca ccgagcgcga ggtcagatgg ctcaacgagc tcatcaggac cgagcacgag       540
     caggcgttcc cggcgccacc gcagcagcaa ccccagcaag gctccccgga gccccggccc       600
     tcctag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page