(data stored in ACNUC7421 zone)

EMBL: CP001700.PE345

CP001700.PE345       Location/Qualifiers
FT   CDS_pept        388574..389653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0347"
FT                   /product="inositol 1-phosphate synthase"
FT                   /note="TIGRFAM: inositol 1-phosphate synthase; PFAM:
FT                   Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein; KEGG:
FT                   sco:SCO3899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69300"
FT                   /db_xref="GOA:C7PVE4"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE4"
FT                   /inference="protein motif:TFAM:TIGR03450"
FT                   /protein_id="ACU69300.1"
FT                   /translation="MGSVRVAIIGVGNCAASLVQGVEYYKDADPNAKVPGLMHVQFGDY
FT                   HVSDLEFVAAFDVDAKKVGLDLADAIGASENNTIKIADVPPTGVVVQRGHTNDGLGKYY
FT                   RQTIVESDAEPVDMVAALKAAKADVVVCYLPVGSQSAVEYYAQVAIDAKVAFVNALPVF
FT                   IAGTKAWADKFEAAGVPIVGDDIKSQVGATITHRVLAKLFEDRGVVLDRTMQLNVGGNM
FT                   DFMNMLERERLESKKISKTQAVTSQLSHDLGAGNVHIGPSDYVAWLDDRKWAYVRLEGR
FT                   AFGDVPLNLEYKLEVWDSPNSAGVIIDAVRCAKIALDRGIGGPILSASSYFMKSPPVQY
FT                   FDDEARDAVEAFIKGEVER"
     atgggttcgg ttcgagtagc gatcatcggc gtcggtaact gcgccgcctc gctggtgcag        60
     ggcgtcgagt actacaagga cgccgacccc aacgccaagg tccccggcct gatgcacgtc       120
     cagttcggcg actaccacgt ctccgacctg gagttcgtcg ccgccttcga cgtcgacgcc       180
     aagaaggtcg ggctggacct ggccgacgcc atcggcgcca gcgagaacaa caccatcaag       240
     atcgccgacg tcccgccgac cggcgtggtc gtgcagcgcg gccacaccaa cgacggcctg       300
     ggcaagtact accgccagac catcgtggag tccgacgccg agccggtcga catggtcgcc       360
     gcgctgaagg ccgccaaggc cgacgtcgtc gtgtgctacc tgccggtggg ctcgcagtcc       420
     gccgtcgagt actacgcgca ggtcgcgatc gacgccaagg tggcgttcgt caacgcgctg       480
     ccggtgttca tcgccgggac caaggcctgg gcggacaagt tcgaggccgc gggcgtcccg       540
     atcgtgggcg acgacatcaa gtcccaggtc ggcgcgacca tcacgcaccg cgtgctggcc       600
     aagctgttcg aggaccgcgg cgtggtgctg gaccgcacca tgcagctgaa cgtcggcggc       660
     aacatggact tcatgaacat gctcgagcgc gagcgcctgg agtccaagaa gatctccaag       720
     acccaggccg tcacctcgca gctgtcccac gacctcggcg ccggcaacgt gcacatcggc       780
     ccgtcggact acgtggcctg gctcgacgac cgcaagtggg cctacgtgcg cctcgagggc       840
     cgcgcgttcg gcgacgtccc gctgaacctg gagtacaagc tcgaggtctg ggactccccg       900
     aactccgccg gcgtcatcat cgacgcggtg cgctgcgcca agatcgcgct ggaccgcggt       960
     atcggcggcc cgatcctgtc ggcctcgtcc tacttcatga agtccccgcc ggtgcagtac      1020
     ttcgacgacg aggcgcgcga cgccgtcgag gccttcatca agggtgaagt cgagcgctga      1080
//

If you have problems or comments...

PBIL Back to PBIL home page