(data stored in ACNUC7421 zone)

EMBL: CP001700.PE346

CP001700.PE346       Location/Qualifiers
FT   CDS_pept        389821..392364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0348"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1461 cell wall binding
FT                   repeat 2- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69301"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE5"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69301.1"
FT                   /translation="MGRKREISVISSLVVAGAAFGGSVVSAPTASAASITVSASGADVV
FT                   AINPAMFGGGAPTDQVSTQLAQILRNSARYLGTTWYNQTYGNSLASDGYLNLDIPGAVP
FT                   EQSFRLPGMAAVSIATAVKLGDWDAGASGISADEAENRAATMVRALAHRYYANNSLAGV
FT                   STWGNSWQSPLWAFYTGQAAWLVWDKLSPSERNDVARMMADEANRLLTGNDVYLTSDTG
FT                   SQQLYQYNRGGTDVTPGDTKAEEDNYEAQLLGLAVAMMPNHPNAARWQRRNEDLLIADT
FT                   ATPDDLTNSAAGNAVVNGRQLNQWLQGYNMQADGTVQNHDILHPLYMTALDQSLQQVGT
FT                   FALAGQCAPQAATNNVGLTYKALTTQTSFPYAPDPNNLTQDVTAKTPDGKPIYESTSSP
FT                   QINYPQGNDWGTQFPAYYGSFDALVSAYSPYLVGENNQAPTATANAVTHLQSEISLQSR
FT                   FGDGQTYQPWNPATTPGDKAENSYVGAEQRVGQITAQAYMAEFLNHHSRGCFTNSGNPT
FT                   PPNVPPVQPTAVSRLSGTDRYGTGVAVSQAQWSNAGGDNTPRAIADAVVLARGDNFPDA
FT                   LAGTPLAKRDRGPLLLTEPGALNPVTANEIKRVLPKGKTVYILGGNQAVSPKVQSQLVA
FT                   LGYTVKRFGGSDRYQTALLIAQQGMGSPHQVVVATGQDFADALAAGPLAADEGNAILLS
FT                   NGKTLDANTKAYIAGAQRKNGAADPAFHLNAVGGAAVAATHYLGSQSHALMGNDRYQTA
FT                   AAVAARFAADMPVTQFGVATGTQFADALTGGAFMANANEPLLLTAPTALAPSDTTLLHG
FT                   MRSQLSAVTLFGGPVALKQAVMDQIAHAVGGVERR"
     atgggccgca agcgcgaaat atcggtcata tcgagtctcg tggtggcggg ggcggccttc        60
     ggcggtagcg tcgtctcggc ccccacggcc tcggccgcga gcatcaccgt ctccgcctcc       120
     ggggcggacg tcgtggcgat caaccccgcg atgttcggcg gcggtgcgcc gaccgaccag       180
     gtgagcacgc agctcgcgca gattctgcgc aactccgcgc ggtacctggg gacgacttgg       240
     tacaaccaga cctacggcaa cagcctggcc tccgacggat atctgaacct ggacatcccc       300
     ggcgccgtcc ccgagcagag tttccgcctg ccgggcatgg ccgcggtgtc catcgcgacc       360
     gcggtgaagc tgggcgactg ggacgccggc gcctccggca tcagcgccga cgaggcggag       420
     aaccgcgccg cgaccatggt gcgcgcgctg gcccaccgct actacgccaa caactcgctg       480
     gccggcgtgt ccacgtgggg caacagctgg cagtcgccgc tgtgggcgtt ctacaccgga       540
     caggcggcgt ggctggtgtg ggacaagctg tccccctccg aacgcaacga cgtggcccgc       600
     atgatggccg acgaggcgaa ccggctgctc accggcaacg acgtctatct gacctcggac       660
     accggcagcc agcagctgta ccagtacaac agaggcggca ccgacgtcac ccccggcgac       720
     accaaggccg aggaggacaa ctacgaggcg cagctgctcg ggctggccgt ggcgatgatg       780
     ccgaaccacc cgaacgccgc caggtggcag cgccggaacg aggacctgct gatcgcggac       840
     accgcgacgc cggacgacct caccaactcc gctgccggca acgccgtggt caacggccgc       900
     cagctgaacc agtggctcca gggctacaac atgcaggccg acggcacggt gcagaaccac       960
     gacatcctgc atcccttgta catgacggcg ctggaccagt ccttgcagca ggtcgggacc      1020
     ttcgcgctgg ccggtcagtg cgcgccgcag gctgcgacga acaacgtcgg tctgacgtac      1080
     aaggctctga ccacacagac gtcgttcccc tacgcgccgg acccgaacaa cctgacgcag      1140
     gacgtcaccg ccaagacgcc cgacgggaag ccgatctacg agtcgacgag ctcgcctcag      1200
     atcaactacc cgcagggcaa tgactggggc acgcagttcc cggcgtacta cgggtccttc      1260
     gacgcgctgg tcagcgccta cagcccgtat ctggtcggtg agaacaacca ggcgccgacc      1320
     gcgaccgcga acgccgtgac gcatctgcag tccgagatca gcctgcagag ccggttcggc      1380
     gacgggcaga cctaccagcc gtggaacccg gccaccacgc cgggcgacaa ggcggagaac      1440
     tcctacgtcg gtgccgagca gcgggtcggc cagatcacgg cgcaggccta catggcggag      1500
     ttcctcaacc accacagccg gggctgcttc accaactccg gcaacccgac cccgccgaac      1560
     gtcccgccgg tgcagcccac cgcggtctcg cggctgtccg gcaccgaccg ctacgggacc      1620
     ggcgtcgcgg tgtcgcaggc gcagtggtcc aacgccggcg gcgacaacac gccccgggcg      1680
     atcgccgacg cggtggtcct ggcgcgcggc gacaacttcc cggacgcgct ggccggcacc      1740
     ccgctggcca agcgcgaccg cggtccgctg ctgctgaccg agcccggagc gctgaacccg      1800
     gtgaccgcca acgagatcaa gcgggtcctg ccgaagggca agacggtcta catcctgggc      1860
     ggcaaccagg cggtctcgcc gaaggtgcag tcgcagctcg tggctctggg ctacacggtg      1920
     aagcgcttcg gcggctccga ccgctaccag accgcgctgc tcatcgccca gcagggcatg      1980
     ggctccccgc accaggtcgt ggtggccacc ggccaggact tcgccgacgc cctggccgcc      2040
     ggcccgctgg cggccgacga gggcaacgcg atcctgctgt ccaacggcaa gacgctggac      2100
     gcgaacacca aggcctacat cgccggcgcg cagcgcaaga acggcgccgc ggacccggcc      2160
     ttccacctca acgcggtggg cggcgcggcg gtcgcggcga cccattacct gggcagccag      2220
     tcgcacgccc tgatgggcaa cgaccggtac cagacggccg ccgccgtcgc cgcccgcttc      2280
     gccgccgaca tgccggtgac ccagttcggc gtggcgaccg gcacgcagtt cgcggacgcc      2340
     ctgaccggcg gcgcgttcat ggccaacgcc aacgagccgc tgctgctgac ggcgccgacg      2400
     gccctggcgc cgtcggacac caccctgctg cacgggatgc gcagccagct gtcggcggtc      2460
     acgctgttcg gcgggccggt cgccctcaag caggccgtga tggaccagat cgcgcacgcg      2520
     gtcggcgggg tcgagcggcg ctga                                             2544
//

If you have problems or comments...

PBIL Back to PBIL home page