(data stored in ACNUC7421 zone)

EMBL: CP001700.PE347

CP001700.PE347       Location/Qualifiers
FT   CDS_pept        392494..393327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0349"
FT                   /product="protein of unknown function DUF1684"
FT                   /note="PFAM: protein of unknown function DUF1684; KEGG:
FT                   sco:SCO1747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69302"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE6"
FT                   /inference="protein motif:PFAM:PF07920"
FT                   /protein_id="ACU69302.1"
FT                   /translation="MSETEQTATIPAAPADWYQWAEKREASVSGEYGVLALVGTHWLDE
FT                   GPAVSIDGLPGLWAAAGHRVSVTALPADALLVDGVPVDGVRFLDPDLALDPSVLFHHGR
FT                   KLVPIIREGVLALRVYDPEAENRRSFAGISRFPYDPALVFTARYERYVHGHVERVLNAD
FT                   GKERGLALNGDLVFEHGGAEYRLAVTANGGEDFDVTFGDATNGPDTFGFRQLTVPAPHL
FT                   DDPDNPDSGTTVLDFNRAQLPPCAFSDHFICPVPPVGNRLELAVAAGEKRREVRT"
     atgtccgaga cggagcagac cgcgacgatc cccgccgctc ccgccgactg gtatcagtgg        60
     gctgagaagc gcgaggcgtc ggtgtccggc gagtacggcg tcctcgctct cgtcgggacg       120
     cactggctgg acgagggtcc ggccgtgtcg atcgacgggc tgccgggtct gtgggccgct       180
     gccggccatc gggtgagcgt caccgccttg cccgccgacg cgctgctggt cgacggcgtc       240
     ccggtcgacg gcgtgcggtt cctcgaccct gatctcgcgc tggatccgag cgtgctgttc       300
     caccacggcc gcaagctggt gccgatcatc cgcgagggcg tcctcgcgct gcgggtctat       360
     gaccccgaag ccgagaaccg ccgcagtttc gcggggatct cgcgcttccc ctacgacccg       420
     gcgctggtct tcacggcgcg gtacgagcgg tacgtccacg gccatgtcga gcgggtgctg       480
     aacgccgacg gcaaagagcg cgggctcgct ctgaacggcg acctcgtctt cgagcacggc       540
     ggcgccgagt accggctcgc cgtgacggcc aacggcggcg aggacttcga cgtgaccttc       600
     ggcgacgcga ccaacgggcc cgacacgttc ggcttccgcc agctgacggt tccggcgccg       660
     cacctcgacg acccggacaa ccccgacagc ggcacgaccg tcctggactt caaccgcgcg       720
     cagctgccgc cctgcgcctt cagcgaccac ttcatatgcc cggtcccgcc ggtcggcaac       780
     aggctggagc tggccgtggc ggcgggggag aagcggcgcg aggtgcgaac ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page