(data stored in ACNUC7421 zone)

EMBL: CP001700.PE348

CP001700.PE348       Location/Qualifiers
FT   CDS_pept        393416..393871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0350"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   fre:Franean1_1175 BadM/Rrf2 family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69303"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE7"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACU69303.1"
FT                   /translation="MQISAKADYAVRVMLELAAHGPNLVKSTVLIDHQGLPRKFVESIL
FT                   VELRRADLIRSHRGAEGGYTLARPASAISIGQVIRAVDGPLAEVRGLRPHETEYSNAAQ
FT                   HLSDVWVAARAALRKVLDETSLAHVLSGKLPAHVRRMAESPEAWLPR"
     gtgcagatct cagcaaaagc cgactacgcg gtccgggtga tgctcgagct cgcggcccac        60
     ggaccgaacc tggtgaagtc cacggtcctg atcgaccacc agggtctgcc ccgcaagttc       120
     gtcgaatcga tcctggtcga actccgccgc gccgacctca tccgcagcca ccgcggcgcc       180
     gaaggcggct acaccctggc ccggccggcc tccgcgatct ccatcggcca ggtcatccgc       240
     gccgtggacg gtccgctggc cgaggtccga ggcctgcgcc ctcacgagac cgagtacagc       300
     aacgccgcgc agcacctctc cgacgtctgg gtcgccgccc gcgcggcgct gcgcaaggtg       360
     ctcgacgaga cgagcctcgc gcacgtactc agcggcaagc tgccggcgca cgtgcggcgg       420
     atggcggagt cgccggaggc ttggctgcct cggtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page