(data stored in ACNUC7421 zone)

EMBL: CP001700.PE35

CP001700.PE35        Location/Qualifiers
FT   CDS_pept        34710..36773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0035"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: sgr:SGR_3728 putative
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68990"
FT                   /db_xref="GOA:C7QFQ1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ1"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACU68990.1"
FT                   /translation="MALVLRYAIRSHVGLIREGNEDSGYAGPRLLAIADGMGGAAAGEL
FT                   ASAVVMTTVSRLDSPGGEDLLSGTGEMPVMAPGGAGPGQGQPAPGAPGGGPGGQGGPGG
FT                   VPENEQTLHISQHDMAARESGNAHSPADPAFGEPDLALLGGAVVAANERLRAIVAERPE
FT                   LEGMGTTLTAMLWSGGRFGMVHVGDSRAYRLRDGLLEQMTADHTWVQRLIDEGRITEEE
FT                   AGHHPQRSLLMRVLDGRTQVEADIGTFDAYPGDRYLLCSDGLSGFVSQETLAETLAAYA
FT                   DPQQAVDALIELALRAGGPDNITCIVADTLDDGTIPGASPNESTQMLGSLTPVVVGAAS
FT                   EGVEQLPRFSTQGSGGPGPGPQQDDFPQNHPAGRAARLRSRRNQNQNSQNQNAQNQQLA
FT                   AEQHPGGPVTTAQQQFDPSAQTTELDSVPGQRGLVPGAENQQPGSRRNADGGYGGAPDG
FT                   GPGGPGGPAPAKRGKKGLIITGAVVVVLAAAAGGAYVYSQGQYYVTPSTDSKQVLLYQG
FT                   LSQVSFASSQQTMSEGPLWIASVPQSKRADLFKTESFGSKGAALSYLEQYRSAAKSCAD
FT                   YRHNQLVVQSHPQQSAVTGKTAGTTVPGQNLAPSAPPTSSKAGAPLANGPANTVQNPTA
FT                   PTGDPAGTTAPTGGEQGSPEPQNPTSSPSAPASQPGDDPQMKAYCAGTTDGP"
     atggctcttg tgctcaggta cgcgatccgc tcccatgtcg ggctgatccg ggagggcaac        60
     gaggactccg gttacgccgg cccgcggctg ctggcgatcg ccgacggcat gggcggcgcc       120
     gccgccggtg agctggccag cgctgtcgtg atgacgacgg tctcgcggct ggactccccc       180
     ggcggcgagg acctgctgtc cggcaccggg gagatgcccg tgatggcgcc cggcggcgcc       240
     ggtcccggcc agggccagcc tgctcccggc gccccgggcg gcggtccggg cggtcaaggc       300
     ggtcccggcg gcgtgccgga gaacgagcag accctgcaca tctcccagca cgacatggcc       360
     gcccgcgagt ccggcaacgc gcactcgccg gccgaccccg ccttcggcga gcccgacctg       420
     gcgctgctgg gcggcgcggt ggtggcggcc aacgagcggc tgcgcgcgat cgtggccgag       480
     cgcccggagc tggagggcat gggcaccacg ctgaccgcga tgctgtggtc cggcggccgt       540
     ttcggcatgg tgcacgtcgg cgactcccgt gcctaccgcc tgcgcgacgg cctgctggag       600
     cagatgaccg ccgaccacac ctgggtgcag cgcctaatcg acgagggccg gatcaccgag       660
     gaggaggccg gccaccaccc gcagcgctcc ctgctgatgc gcgtcctgga cggccgtacg       720
     caggtcgagg cggacatcgg caccttcgac gcctaccccg gcgaccgcta cctgctgtgc       780
     tcggacggtc tgtcaggatt cgtctcccag gagaccctgg ctgaaaccct ggccgcctac       840
     gccgatccgc agcaggctgt cgacgccctg atcgagctgg ctctgcgcgc cggcggtccg       900
     gacaacatca cctgcatcgt cgccgacacc ctcgacgacg gcacgatccc cggcgccagc       960
     ccgaacgagt ccacgcagat gctggggtcg ctgaccccgg tggtggtcgg cgcggccagc      1020
     gagggcgtgg agcagctgcc ccggttcagc acccagggtt ccggcgggcc cggtcccggt      1080
     ccgcagcagg atgatttccc gcagaaccac ccggccggcc gcgccgcccg gctgcgttcg      1140
     cgccgcaacc agaaccagaa ctcgcagaac cagaacgccc agaaccagca gctggccgcc      1200
     gagcagcatc ccggcggacc ggtgaccacc gcgcagcagc agttcgaccc ctccgcccag      1260
     accactgagc tggactcggt gcccgggcag cgaggtctgg tgcccggcgc ggagaaccag      1320
     cagcccgggt cgcggcgcaa tgccgacggc gggtacggcg gcgctcccga cggtggtccc      1380
     ggaggtcccg gcggaccggc tccggccaag cggggcaaga agggcctgat catcaccggc      1440
     gcggtggtcg tggtgctggc cgcggccgcg ggcggggcgt acgtgtacag ccaggggcag      1500
     tactacgtga cgccgtccac ggacagcaag caggtgctgc tctaccaggg cttgtcgcag      1560
     gtgtcgttcg cctcgtcgca gcagacgatg tccgagggtc cgctgtggat cgcctcggta      1620
     ccgcagagca agcgcgccga cctgttcaag accgagtcct tcggctccaa gggcgccgcg      1680
     ctgagctacc tggagcagta ccggtcggcc gcgaagtcct gtgccgacta ccggcacaac      1740
     cagctggtcg tccagagtca cccacagcag agcgccgtga ccggcaagac ggcgggcacc      1800
     acggtgccgg ggcagaacct cgccccgtcc gcgccgccca cgtcgtcgaa ggccggcgcc      1860
     ccgctggcca acggtccggc gaacactgtg cagaacccca ccgcgccgac cggcgacccc      1920
     gccggcacga ccgccccgac cggcggcgag caggggtcac cggagccgca gaatcccacg      1980
     tcgtccccct cggcgcccgc gtcgcagccc ggtgacgacc cgcagatgaa ggcgtactgc      2040
     gccggaacaa cggacggtcc ttag                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page