(data stored in ACNUC7421 zone)

EMBL: CP001700.PE350

CP001700.PE350       Location/Qualifiers
FT   CDS_pept        complement(394286..397018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0352"
FT                   /product="Peptidase S53 propeptide"
FT                   /note="PFAM: Peptidase S53 propeptide; KEGG: sma:SAV_5949
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69305"
FT                   /db_xref="GOA:C7PVE9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVE9"
FT                   /inference="protein motif:PFAM:PF09286"
FT                   /protein_id="ACU69305.1"
FT                   /translation="MVGRFRHVTATLAVAALMAAPNAVSAATTSVTAADGPTTARIGLA
FT                   GADPDGLQQLARAVADPHSTQYRHFLTPAQLQAKYGPTPAQLKQVHQWLTTGGLTITGE
FT                   NAHWIDVAGSSAKVRKAFGHLPQLRIRQGIGAGYAARAAATVPPALAGAVSSVAGLMPE
FT                   RQGMRQFSYRVMTGARSRALTGGGVDPGGPMQPAQPAAPGGQGGQGGPLQPTQGTQVNP
FT                   GGPMQPAQPAAPGTQGGQNGPVQPTLGTQINPGGPMQPAQPAAPGTQGSQGGPVQPTSG
FT                   AQPAQPAAPGTQRASVQQAPRTQINPGGPMQPAQPAQPAAPGTQRASMQQAPRTQINPG
FT                   GLMRPATREMPAAQVDPGGPMQPSAPVMPAPKGPVGSGGAGGGVNPGGPMQPSGPAGSA
FT                   GPVGPIVVGGPIRRSLPGGAGGLVSPSVSSTACSADWGASPAVGVPEGYNKPDPLVACG
FT                   LTPKRLRAAYGVTAAGFSGRGAIIGIVDAYGSPTMRADADAFAKSVGDLAFGAGQYMES
FT                   VDRGAWKHLGDGVCETPAAWGGEEALDVEVAHGLAPGAVVHYFGAASCQDQDIAAMLAS
FT                   IVDKHLADEVTGSFGEIMHSAGGDIDPALVMQENQIFTTGAAEGIGFAFATGDCGDQAA
FT                   GLSGPGCDTGSARAQVEWPAASPWVTAVGGTALAVAPNGTRRWEAPMGDLRSDLSADGS
FT                   KWAPLPGQFFFGGGGGLSGDFDQPAYQKGVVPADLASPVVGGKATGKASGTASGKAAST
FT                   AVGPAKRTVPDVAMDGDLLTAVLTGHTDPTLGGYGQDVIGGTSAAAPMFAAVQADAMQA
FT                   AGGALGFANPALYKRSGTKQFTDIVAGPKGAPNPISAVVDHGTFGDVHEARLFKLGADH
FT                   GLSARKGYDTATGLGSPTAAYITSFKPAPSKTGTGKKKP"
     atggttgggc ggttcaggca cgtcacggcc acgctggcgg tcgcggcact gatggcggca        60
     ccgaacgcgg tgtcagccgc gaccacctcc gtaacagcag cggatggtcc tactactgcg       120
     cgaatcgggt tggccggcgc cgacccggac ggcctccagc aactggcacg cgcggtagcc       180
     gacccacaca gcacgcaata ccggcacttc ctcacccccg cgcagctcca ggccaagtac       240
     ggcccgaccc cggcgcagct gaagcaggtc caccagtggc tcaccaccgg cggcctgacg       300
     atcaccggcg agaacgccca ctggatcgac gtcgccggct cctcggcgaa ggtgcggaag       360
     gccttcgggc acctgcccca gctgcgaatc aggcagggca tcggcgccgg gtacgcggca       420
     cgggctgcgg caacggttcc gccggcactg gcaggggcgg tgtcgagcgt cgcgggactg       480
     atgccggagc ggcaggggat gcggcagttc tcatatcggg tgatgacggg agcgcggagc       540
     agggcgctga ctggcggcgg ggtcgatccc ggcgggccga tgcagccggc gcagccagcg       600
     gctccgggcg ggcagggcgg ccaaggcggg ccgctgcagc cgactcaggg cacgcaggtc       660
     aaccccggcg ggccgatgca gccagctcag cctgcggctc cgggtacgca gggcggccaa       720
     aacggtccag tgcagccgac cttgggcacg cagatcaatc ccggcggacc gatgcagcca       780
     gcccaaccgg cagctccggg cacgcaaggc agccagggcg gtccggtgca gccgacgtcg       840
     ggcgcacagc cagctcaacc agcagctccg ggcacgcagc gcgcttcggt gcagcaggcg       900
     ccgcgcacgc agatcaatcc cggcggaccg atgcagccag cccagccagc ccagccggca       960
     gctccgggca cgcagcgtgc ttcgatgcag caggcgccgc gcacgcagat caatcccggc      1020
     ggcctgatgc ggccagccac tcgtgagatg cctgccgcgc aggtggatcc tggcgggcct      1080
     atgcagccgt ctgcgccggt gatgcctgcg ccgaagggtc ctgtggggtc ggggggtgcg      1140
     ggtggcgggg tgaatcctgg cggcccgatg cagccgtctg ggcctgcggg gtctgcgggc      1200
     ccggtggggc cgattgttgt tggtgggccg attcggcgga gtttgccggg tggtgcgggt      1260
     gggctggttt cgccgtccgt cagctccact gcgtgctctg ccgactgggg tgcctctccg      1320
     gcggttggtg tgccggaggg gtacaacaag cctgatccgc tggtggcgtg tgggcttact      1380
     ccgaagcggc tgcgggctgc ttatggggtc acggcggctg ggttcagtgg gaggggggcg      1440
     atcatcggga ttgtggatgc gtatgggtct ccgaccatgc gggctgatgc tgatgcgttc      1500
     gcgaagtcgg tgggggactt ggcttttggc gcgggtcagt acatggagtc cgtggatcgg      1560
     ggtgcgtgga agcatctggg ggacggcgtg tgtgagacgc ctgcggcgtg gggtggggag      1620
     gaggcgctgg atgtcgaggt ggcgcatggg ctggcgccgg gtgcggtcgt gcactacttc      1680
     ggcgcggctt cgtgtcagga tcaggatatt gccgccatgt tggcgtcgat tgtcgacaag      1740
     catttggctg acgaggtgac cggttcgttc ggcgagatca tgcactctgc cggtggggac      1800
     atcgatccgg cgctggtcat gcaggagaac cagatcttca ccaccggcgc ggctgagggc      1860
     atcgggttcg cgttcgccac cggtgactgc ggggaccagg cggcggggct gagcgggccg      1920
     gggtgcgaca ctgggtcggc gcgggcgcag gtggagtggc cggcagcgtc gccgtgggtg      1980
     acggcggtcg gcgggacggc gctggccgtc gcgccgaacg ggacgcggcg ctgggaggcg      2040
     ccgatgggcg acctgcgttc agacctgtcc gcggacggga gtaagtgggc tccgctcccg      2100
     gggcagttct tcttcggcgg tggcggcggt ctcagtggcg acttcgatca gccggcgtat      2160
     cagaagggcg tggtgccggc ggatctggcg agcccggtgg tcggcggcaa ggcgactggc      2220
     aaggcgagtg gcacggcgag cggcaaggca gccagcacgg cagtcggccc ggcgaagcgc      2280
     accgtccccg acgtcgcgat ggacggcgac ctcctgaccg ccgtcctcac cggccacacc      2340
     gacccgaccc tcggcggcta cggccaggac gtcatcggcg gcacctccgc cgccgcgccg      2400
     atgttcgccg cggtgcaggc ggacgccatg caggcggcgg gcggcgcgct cggcttcgcc      2460
     aaccccgcgc tgtacaagcg gtccggcacg aagcagttca ctgacatcgt cgccggcccg      2520
     aagggagcgc cgaacccgat ctcggcggtc gtggaccacg gcacgttcgg cgacgtgcac      2580
     gaggcgcgcc tgttcaagct gggcgcggac cacggcctga gcgcccgcaa ggggtacgac      2640
     acggcgaccg ggctcggctc accgacggcg gcgtacatca cctcgttcaa gccggcgccg      2700
     agcaagaccg gcaccgggaa gaagaagcct tga                                   2733
//

If you have problems or comments...

PBIL Back to PBIL home page