(data stored in ACNUC7421 zone)

EMBL: CP001700.PE351

CP001700.PE351       Location/Qualifiers
FT   CDS_pept        complement(397134..398669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0353"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fre:Franean1_3555 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69306"
FT                   /db_xref="GOA:C7PVF0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU69306.1"
FT                   /translation="MRKWLPLVAVCLGTFMLLVDVTIVTVALPDMARSLDTTFADLQWV
FT                   MDVYALVLAALLLAAGSLGDRAGHRRLYVAGLVVFAAASLACGLATSPGVLIAFRAVQG
FT                   VGGAAMLATTVALISHLYSGRDLGTAFGVWGAVSGAAAAAGPIMGGLLTQHLDWRWIFF
FT                   VNLPISVAAVAMTLRYVGESRGERRRGLDLPGLLTFTAAAGLATYALIKGNDYGWGSAR
FT                   TIGVFAGAAVALVAFVVAELRVRTPLLDLSLFRRGTFTGVMIGALLLSGAAFSYFAYES
FT                   LWLQSALGMSPVTAGLCFVPMSGAAFVTAGLGGRLLEDRLSPRVMIGGGLLLIAAGSAA
FT                   QMLVSAGSSWTVLVPGLVVSGVGVGLATPTLVSTAVAAVGYQRAGMASGAVNTARQLGN
FT                   ALGIAVLGVVFHAGLASSVRGAGVPQSAAVADALAAGQTRGVLASGPAAQRPALEHMVH
FT                   AAFASGLRSAFLAAAVMGAVGGLAVLALVRRPGGGHAPGEQSSAANVPIPAEA"
     atgcgcaagt ggctaccgct cgtcgcggtc tgcttgggga cgttcatgct gttggtggac        60
     gtcaccatcg tcaccgtcgc cctgcccgac atggcccgga gcctggacac cacgttcgcc       120
     gacctccagt gggtcatgga cgtctacgcc ctggtgctcg ccgcgctgct gctggccgcc       180
     ggctcgctcg gcgaccgcgc cgggcaccgc cggctctacg tcgccgggct cgtcgtcttc       240
     gccgccgcct cgctggcctg cggcctggcc acgagtcccg gcgtgctgat cgcgttccgc       300
     gccgtgcagg gcgtcggggg cgcggcgatg ctggccacca cggtcgccct gatcagccat       360
     ctgtattccg ggcgcgacct gggcaccgcc ttcggggtct ggggcgcggt cagcggcgcg       420
     gccgcggcgg ccgggccgat catgggcggg ctgctcaccc agcacctgga ctggcgctgg       480
     atcttcttcg tcaacctgcc gatcagcgtg gcggcggtgg cgatgacgct gcggtacgtc       540
     ggggagtcgc gcggggagcg gcgccgcgga ctggacctgc cgggcctgct gacgttcacc       600
     gcggcggcgg gactggcgac gtacgcgctg atcaagggca acgactacgg ctggggctcc       660
     gcacgcacga tcggggtctt cgccggggcg gcggtggcgc tggtcgcgtt cgtcgtggcg       720
     gagctgcggg tgcggacgcc gctgctggac ctgagcttgt tccggcgcgg gacattcacc       780
     ggtgtgatga tcggtgcgct gctgctgtcg ggggcggcgt tctcctactt cgcgtacgag       840
     tccctgtggt tgcagtcggc gctgggcatg agcccggtga cggccgggct gtgcttcgtg       900
     ccgatgagcg gggcggcgtt cgtcaccgcc ggactcggcg ggcggctgct ggaggaccgg       960
     ctctcgccgc gggtgatgat cggcggcggt ctgctgctga tcgcggccgg ttcggcggcg      1020
     cagatgctgg tcagcgccgg gtcgagctgg accgtgctgg tgccaggact cgtggtcagc      1080
     ggagtcgggg tcgggctggc cacgccgacg ctggtgtcga cggcggtcgc cgcggtcggg      1140
     taccagcgtg cggggatggc cagcggcgcg gtgaacacgg cgcggcagct ggggaacgcg      1200
     ctgggcatcg cggtgctcgg ggtggtgttc cacgccgggc tggcttcctc ggtgcggggt      1260
     gcgggcgtgc cgcagtcggc ggcggtcgcc gacgcgctgg cggctgggca gacccgcggc      1320
     gtgctggcat cgggaccggc cgcgcaacga cccgcgctgg agcacatggt gcacgcggcg      1380
     ttcgcctccg ggctgcgctc ggcgttcctg gcggcagccg tcatgggagc ggtcggcggc      1440
     ctcgcggtgc tggcgctcgt gcggcggccc ggcggcggtc acgcaccggg ggagcagtcg      1500
     agcgctgcga acgtgccgat ccccgccgag gcgtga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page