(data stored in ACNUC7421 zone)

EMBL: CP001700.PE352

CP001700.PE352       Location/Qualifiers
FT   CDS_pept        398804..399820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0354"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: sma:SAV_1846
FT                   transcription regulator AsnC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69307"
FT                   /db_xref="GOA:C7PVF1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF1"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACU69307.1"
FT                   /translation="MSTDQRVEEFDRLDRQLAQALMIDGRASFSRLAEVLGVTDQTVTR
FT                   RYRRLRSGGLLRVIGLPLGNRVGLYQSNVRVQCVPGAAGAIADALARRRDIGWVTINAS
FT                   GTEVSCMTRSPSRRERDLLLLDKLPRTRQVTGVSVKTIMHAFVGGPGGWPGLAADLGAD
FT                   QAAALHRDFPEVPGEFELDDADHALLAVLARDGRAPYPELAAAVGKSESTVRRRVEHLM
FT                   DNGVLYFDVEVLPVHLGFHVEAMVSAAVAPSDLDAVGRAVGSHPEVPFAAATTGPTNLA
FT                   AVVVCREIQDLYEYVTGRMGAIKEIGQLEVVQVLRTVKRAGLLTDGVRLFDPPETVY"
     atgagcaccg accagcgcgt cgaggagttc gaccgcctcg accgccaact cgcgcaagcc        60
     ctgatgatcg acggccgcgc ctcgttcagc cggctggccg aggtgctcgg cgtcaccgac       120
     cagaccgtga cccgccgcta ccgccgcctg cgaagcggcg gcctgctaag ggtgatcggc       180
     ctgccgctgg gcaaccgcgt cgggctctac cagtccaacg tccgcgtcca gtgcgtcccc       240
     ggcgcggccg gtgcgatcgc cgacgcgctg gcccgccgcc gcgacatcgg ctgggtgacg       300
     atcaacgcca gcggcaccga agtgtcctgc atgacccggt ccccctcccg gcgcgagcgc       360
     gacttgctgc tgctcgacaa gctgccgcgc acccggcagg tcaccggggt gtcggtgaag       420
     acgatcatgc acgccttcgt cggcggtccc ggcggctggc cgggtctggc cgccgacctc       480
     ggcgcggacc aggccgccgc gctgcaccgg gacttccccg aggtcccggg cgagttcgag       540
     ctcgacgacg ccgaccacgc cctgctcgcc gtcctggcgc gggacggccg cgcgccgtac       600
     ccggaactgg ccgccgccgt cggcaagtcc gagtcgaccg tccggcgccg cgtggagcac       660
     ctgatggaca acggcgtgct ctacttcgac gtcgaggtcc tgccggtcca cctgggcttc       720
     cacgtcgagg cgatggtgag cgcggcggtg gcgccctcgg acctggacgc cgtgggccgc       780
     gcggtcggct cgcaccccga ggtcccgttc gccgccgcga ccaccggtcc caccaacctg       840
     gccgccgtcg tggtctgccg ggagatccag gatctgtacg agtacgtgac cggccgcatg       900
     ggtgcgatca aggagatcgg gcagctggaa gtggtgcagg tgctgcgcac ggtgaagcgt       960
     gcgggcctgc tcacggacgg cgtgcggctg ttcgatccgc cggagaccgt gtactga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page