(data stored in ACNUC7421 zone)

EMBL: CP001700.PE353

CP001700.PE353       Location/Qualifiers
FT   CDS_pept        complement(399928..400599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69308"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69308.1"
FT                   /translation="MSTAAETAGSKPINYRLNLGEGWTRIRLDDHAEADVNAFLDTVFA
FT                   AVPADAAEAGRDLIGGRLTTQIVAGRAKGGIDFYIPTPGGGPVPALTVMASEVKIPSAA
FT                   VPEPADVVARVAASNPTARTGVIAGMPAVRIDRSAGAGLDAEPAGEDAEEDKDGFQPPR
FT                   PRHIEYVVPVAGDPDHRWLSIALTGQAGPGGDEAKVDAAISRFDQAVADLAWTEGEGSG
FT                   A"
     atgtcgacgg ccgccgagac cgcgggcagc aagcccatca actaccgctt gaacctgggt        60
     gaggggtgga cccggatccg cctggacgac cacgccgagg ccgacgtcaa cgccttcctg       120
     gacacggtct tcgccgcggt cccggccgac gccgccgagg ccggccggga cctgatcggc       180
     ggccggctga ccacgcagat cgtcgccggc cgggccaagg gcgggatcga cttctacatc       240
     ccgacgccgg gcggcgggcc ggtcccggcg ctgaccgtga tggcctcgga ggtgaagatc       300
     cccagcgccg cggtcccgga accggccgac gtggtggccc gggtcgccgc ctcgaacccg       360
     accgcgcgca ccggcgtgat cgccgggatg cccgccgtgc gcatcgaccg cagcgccggc       420
     gccggcctgg acgccgagcc ggccggggag gacgccgagg aggacaagga cggcttccag       480
     ccgccgcggc ctcggcacat cgagtacgtc gtcccggtgg ccggggaccc ggaccaccgc       540
     tggctctcca tcgcgctgac cggccaggcc ggcccgggcg gggacgaggc gaaggtggac       600
     gccgcgatct cgcggttcga ccaggcggtc gccgacctgg cgtggaccga gggcgagggt       660
     tcgggcgcct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page