(data stored in ACNUC7421 zone)

EMBL: CP001700.PE354

CP001700.PE354       Location/Qualifiers
FT   CDS_pept        400940..401581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69309"
FT                   /db_xref="GOA:C7PVF3"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69309.1"
FT                   /translation="MGAATALTLLGPAAASAAADTTPAPPAGVTVDVLGGSTPADEHAA
FT                   IDYTIELRDAGTVPYRHVAVTAMLPPGFHILRASPALAASAGPGSMPTWTADLLPGRTV
FT                   DIHAEITAGTVQDLAEAAEPLTGPSDVLDGSGPGSGSSSGAMAWYSLSACAQSGPSGVP
FT                   VCGLSRQLLVKTDDDTRRGIEAMVLILGVPLLVGGLGVYAWRARREPDMD"
     gtgggtgcgg ccacggcact gacgcttctc ggacccgcgg ccgcctcggc cgcggcggac        60
     accacccccg cgccgcccgc cggcgtcacc gtcgacgtcc tcggcggcag cacccccgcg       120
     gacgagcacg cggcgatcga ctacacgatc gagctgcgcg acgccggaac cgtgccctac       180
     cggcacgtcg ccgtcacggc gatgctcccg cccgggttcc acatcctgcg cgccagcccg       240
     gccctcgccg cctccgcggg gccaggctcg atgcccacct ggaccgcgga cctcctcccc       300
     ggccggaccg tggacatcca cgccgagatc accgccggga cggtccagga cctggccgag       360
     gcggccgagc cgctgaccgg gcccagcgac gtgctggacg gctcgggacc cggctccggc       420
     tccagctccg gcgcgatggc ctggtactcc ctgtcggcct gcgcccagag cggaccgagc       480
     ggtgtaccgg tctgcggtct gtcccgccag ctgctggtga agacggacga cgacacccgc       540
     cgcgggatcg aggcgatggt cctcatcctc ggcgtgccgc tgctggtcgg cgggctcggt       600
     gtctacgcct ggcgagcccg acgggagccc gacatggact ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page