(data stored in ACNUC7421 zone)

EMBL: CP001700.PE355

CP001700.PE355       Location/Qualifiers
FT   CDS_pept        complement(401672..402214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0357"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: dge:Dgeo_2488 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69310"
FT                   /db_xref="GOA:C7PVF4"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF4"
FT                   /inference="similar to AA sequence:KEGG:Dgeo_2488"
FT                   /protein_id="ACU69310.1"
FT                   /translation="MDASVWIVNIVVLASVLGTDLGRRKVGMARLLRPAIVAAVIVPMY
FT                   VKHPATSGSGLVLELAAAALGLLLGLGAAALLKVRRNPSDGVIYTHAGVGYAALWTAVI
FT                   GARLLFVYGSNHWFTEQLGRWMTQHQISVDALTDALVVMAIAMLLGRTGTLAAKRRTAV
FT                   TGHVATGASAQRTQVVR"
     gtggacgcca gcgtgtggat tgtgaacatc gtggttctgg cctcggtcct cgggaccgac        60
     ctgggacggc gcaaggtggg catggcgcgt ctgctgcggc cggcgatcgt ggcggcggtg       120
     atcgtgccga tgtacgtgaa gcacccggcc acctccggga gcgggctggt gctggaactg       180
     gccgcggcgg ccctggggct gctgctgggc ctgggcgccg cggcgctgct gaaggtgcgg       240
     cggaacccgt cggacggcgt catctacacc cacgccgggg tcggctacgc ggcgctgtgg       300
     acggccgtca tcggggcgcg gctgctgttc gtgtacggct cgaaccactg gttcaccgag       360
     cagctcgggc gctggatgac gcagcaccag atcagcgtgg acgcgctgac ggacgcgctg       420
     gtcgtgatgg ccatcgcgat gctgctgggg cggaccggga cgctggccgc caagcggcgg       480
     accgcggtca ccgggcacgt cgcgaccggg gcgtcggcgc agcggacgca ggtcgtgcgc       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page