(data stored in ACNUC7421 zone)

EMBL: CP001700.PE356

CP001700.PE356       Location/Qualifiers
FT   CDS_pept        402413..402868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0358"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   sma:SAV_5952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69311"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF5"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACU69311.1"
FT                   /translation="MHLMKSTDLALRLLMRLAVVPPDTHPDELPTTRGVAEAMGAASTH
FT                   MAKVVGKLQHLGLVQARRGRGGGLVLTPAGRVASVGAVVRTFEGSGDLAACVDGEDPCP
FT                   LNAACRLRSALRAAQEAFYASLDQLTVEDVTAAPTGPLLLSIAMGRP"
     atgcacctga tgaagtccac ggatctggcc ctgcgcctgc tgatgaggct cgccgtggtc        60
     ccgcccgaca cccacccgga cgagctgccg accacccgcg gcgtcgccga ggcgatgggc       120
     gccgccagca cgcacatggc gaaggtggtc gggaagctgc aacacctggg cctggtgcag       180
     gcgcgccggg gacgcggcgg cggactggtg ctcaccccgg ccggacgcgt cgcctcggtc       240
     ggggcggtgg tgcgcacctt cgagggctcg ggcgacctcg ccgcctgcgt cgacggcgag       300
     gatccgtgcc cgctcaacgc cgcctgccgg cttcgcagtg ccctgcgtgc cgcccaggaa       360
     gccttctacg cctcgctcga ccagctcacg gtcgaggatg tgaccgccgc gccgaccggt       420
     ccgctgttgc tgtcgatcgc gatggggcgg ccgtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page