(data stored in ACNUC7421 zone)

EMBL: CP001700.PE357

CP001700.PE357       Location/Qualifiers
FT   CDS_pept        complement(402891..404087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0359"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   globin; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: sgr:SGR_2266 putative flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69312"
FT                   /db_xref="GOA:C7PVF6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF6"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ACU69312.1"
FT                   /translation="MLSEQSAATVRATLPVVGAAIGDITERFYARLFQAHPELLRDLFN
FT                   RGNQAAGTQRLALAGSIAAFATQLVEQPGTRPDALLSRIAHKHASLGVSPAQYKVVHQH
FT                   LFAAIAEVLGDAVTPDVAAAWDEVYWLMAHALIAIEGRLSTERGYLVGGTWRDWEVVGR
FT                   REETADVASFLLRPVGGGTPQPFQAGQYVSVQVELPDGARQIRQYSLTSAPDAAVRQIG
FT                   VKRERGTDADPAGEVSNHLHDTVQPGHVLRISAPFGDLVVDAGASEQPLLLASAGIGVT
FT                   PMISILAELVNREHAAPVLVVHADRSPEAHALRSDQNILAAKLISGRTYYWYENDAGES
FT                   GRVGLADLSDVEIPAGTAAFLCGPLPFMRAMREQLLAKGVPAADIHYEVFGPDLWLAA"
     gtgctttccg agcagtcggc cgcgaccgtc cgcgccaccc ttcccgtcgt cggcgccgcg        60
     atcggcgaca tcaccgagcg cttctacgcc cggcttttcc aagcccatcc ggagctgttg       120
     cgcgacctgt tcaaccgggg gaaccaggcc gcgggcacgc agcggctggc gctggccggc       180
     tccatagcgg cgttcgcgac gcagctggtg gagcagcccg gcacgcggcc ggacgcgctg       240
     ctctcgcgca tcgcgcacaa gcacgcctcg ctcggcgtca gcccggcgca gtacaaggtc       300
     gtgcaccagc acctgttcgc ggcgatcgcc gaggtgctcg gggacgccgt caccccggac       360
     gtcgccgcgg cctgggacga ggtctactgg ctgatggccc acgcgctgat cgcgatcgag       420
     ggccggctgt ccaccgagcg cggctacctg gtgggcggca cctggcggga ctgggaggtc       480
     gtggggcggc gcgaggagac cgccgacgtg gcctcgttcc tgctgcggcc ggtcggcggc       540
     gggaccccgc agccgttcca ggccgggcag tacgtgtcgg tgcaggtcga gctgccggac       600
     ggggcgcggc agatccggca gtacagcctg acgtcggcgc cggacgcggc ggtccggcag       660
     atcggcgtga agcgcgagcg cgggacggac gccgatccgg ccggcgaggt ctcgaaccac       720
     ttgcacgaca ccgtgcagcc ggggcacgtg ctgcggatct ccgcgccgtt cggcgacttg       780
     gtggtggacg ccggggcatc ggagcagccg ttgctgttgg cctcggcggg aatcggcgtg       840
     acaccgatga tctcgatcct ggccgagctg gtgaaccgcg agcacgcggc gccggtgctg       900
     gtcgtgcacg ccgaccgcag tccggaggcg cacgcgctgc gctccgacca gaacatactg       960
     gccgcgaagc tgatcagcgg ccggacatac tactggtacg agaacgacgc cggggagtcg      1020
     gggcgcgtgg gtctggcgga tctgagcgac gtggagatcc cggccgggac cgccgcgttc      1080
     ctgtgcgggc cgttgccgtt tatgcgcgcc atgcgggaac agctgctcgc caagggcgtg      1140
     cccgccgccg acatccacta cgaggtcttc ggacccgacc tgtggctggc cgcctag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page