(data stored in ACNUC7421 zone)

EMBL: CP001700.PE358

CP001700.PE358       Location/Qualifiers
FT   CDS_pept        complement(404219..404491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_1411 vitamin B12-dependent
FT                   ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69313"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69313.1"
FT                   /translation="MAQVRLPRQRSSETVSVRVGGYAGRVTVVRPDDRPPQVLLMAGGH
FT                   GSTVAGFADAIGTAISLGLANGAGFDDYRVALELVGLSADQLERE"
     atggcccagg tcaggctgcc gcgtcagcgt tcgtcggaga cggtcagcgt ccgggtcggc        60
     gggtatgccg ggcgggtgac cgtggtgcgt cccgacgacc ggccgccgca ggtgctgctc       120
     atggccggcg ggcacgggtc gacggtcgcg gggttcgccg acgccatcgg gacggcgatc       180
     agcctgggtc tggccaacgg cgccgggttc gacgactacc gggtggcgct ggagctggtg       240
     gggctgagcg ccgaccagct cgagcgggag tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page