(data stored in ACNUC7421 zone)

EMBL: CP001700.PE359

CP001700.PE359       Location/Qualifiers
FT   CDS_pept        complement(404691..405515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0361"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ret:RHE_PE00204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69314"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACU69314.1"
FT                   /translation="MAPLIDYRSPGLFTDVRGVEPAALRGVATDPVDLIRPVSRLVIQP
FT                   HEAEAAGIAAERLAENQIRPAAVLVERLLAVDAAPLSEPREAGKRVVGTCRHFAVLACA
FT                   LLRNAGYAARARCGFATYFQPGQALDHWVIEYRLDDAAHWIRLDPETLGGSVLPNADDL
FT                   SPGDFLTGAEAWAAYRRGEVDGATFGVHGTENFGPAEIKGNAVRDLAAMNKVETLPWDE
FT                   WGRMTDAYAGLTGEDYDALLDELAAACASDDDRALSELYRDPVFEVPAELLL"
     atggcgcccc ttatcgatta ccgctccccg ggactgttca ccgatgtgcg cggcgtcgaa        60
     cccgccgcac tgcggggcgt cgcaacggat ccggtcgatc ttattcggcc ggtctcccgg       120
     ctggtgatcc agccgcacga ggccgaagcc gcggggatcg ccgccgaaag gcttgcggag       180
     aaccagatcc ggccggcggc cgtgctcgtc gagcggctgc tggccgtgga cgccgcgccg       240
     ctgagcgagc cgcgcgaggc cggcaagcgg gtggtgggga cgtgccggca cttcgccgtg       300
     ctcgcctgcg cgctgctgcg gaacgcggga tacgcggcgc gggcgcgctg cgggttcgcg       360
     acgtacttcc agcccggcca ggcgctcgac cattgggtca tcgagtaccg gctcgacgac       420
     gccgcacact ggatccgcct ggaccccgag accctcggcg gcagtgtgct gccgaacgcc       480
     gacgacctgt cgcccggcga tttcctcacc ggcgctgagg catgggcggc gtaccggcgc       540
     ggcgaggtgg acggcgcgac gttcggcgtc cacggcacgg agaacttcgg cccggcggag       600
     atcaagggca acgcggtgag ggacctcgcg gcgatgaaca aggtcgagac cctgccgtgg       660
     gacgagtggg gacgcatgac cgacgcctac gccggtctca ccggcgagga ctacgacgca       720
     ttgctcgacg aattggcggc ggcctgcgcg agcgacgacg atcgcgcgct gagcgagctg       780
     tatcgagacc cggtgttcga agtgcccgct gagctgctgc tttga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page