(data stored in ACNUC7421 zone)

EMBL: CP001700.PE36

CP001700.PE36        Location/Qualifiers
FT   CDS_pept        36782..38761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0036"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: sgr:SGR_3727
FT                   FtsW/RodA/SpoVE family cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68991"
FT                   /db_xref="GOA:C7QFQ2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACU68991.1"
FT                   /translation="MSAAPPRPEEPLIPKRRNTELLLSLFAVAVAMFAYANVGLADNGK
FT                   LPAGMWGVGAGLVVVVLVANGLTRYAAPYADPLFLPLTIFLNGIGLVLIHRLDIYDTEH
FT                   FQALHKLNPVKYHTPPTGSTTNQLMYTALGIIVMAGFLLFIKDHKVLQRYAYISMVSGL
FT                   FLVALPAMLPASMSSRNGAKSWVFLPGGVSIQPAEFGKLLLVSFFAAFLMAKRDALRVA
FT                   SRRVLGLNIPRGRDMGPIAVCWVLAMLILVFETDLGVSLMFFGAFVVLLYIATERTSWL
FT                   VFGVTAFIGGAVFIATTVPHVQARVNNWLHPFTGEICARTAAPGTNCPSDQISQSIYGF
FT                   ATGGIFGKGLDQGRPWLVGFAKNADFILVTVGEELGMVGLFALMMVYTLFVMRGFKTAL
FT                   LIRDNYGKLLAAGLSVTFALQVFITAGGVMRVIPLTGLPMPFLAAGGSALVANWVVVAL
FT                   LIRLSDSARRPLPPAIPLTDDELRAMRLAAAQKMPSNAAPARHAQPAAQTPAGGPPRPH
FT                   PLAQPGLGQTGLAQSGLDQTGLDTPSGSEEPAPPGASDPTEPMPVRRVAAAGAGADDVT
FT                   QAVPSQPRGYGEQTMLRAAEATQAMQATSGPRAEPEQGATESYTPAFEDEDDDDVRTRP
FT                   TPAPGANPGEVPGRPGPTERRYGP"
     atgtcagccg ccccgccccg gcccgaagaa ccactgatcc ccaagcgccg caacaccgag        60
     ctgctgctca gtctgttcgc ggtggccgtc gccatgttcg cctacgccaa cgtgggcctg       120
     gccgacaacg gcaaactgcc ggccggcatg tggggcgtcg gtgcgggcct ggtcgtcgtg       180
     gtgctcgtcg ccaacggctt gacccgctac gccgcgccct acgccgaccc gctgttcctg       240
     ccgctgacga tcttcctcaa cggcatcggc ctggtgctga tccaccgcct ggacatctac       300
     gacaccgagc acttccaggc cctgcacaag ctcaacccgg tcaaatacca caccccgccg       360
     accgggtcga cgacgaacca gctgatgtac accgccctgg gcatcatcgt gatggccggc       420
     ttcctgctgt tcatcaagga ccacaaggtc ctgcagcgct atgcctacat ctcgatggtc       480
     agcggcctgt tcctggtcgc gctcccggcc atgctgccgg cctcgatgtc ctcccggaac       540
     ggcgcgaaga gctgggtgtt cctgccgggc ggggtctcga tacagccggc cgagttcggc       600
     aagctcctgc tggtctcgtt cttcgcggcg ttcctgatgg ccaaacggga cgccctccgg       660
     gtcgcctcgc ggcgggtgct cgggctgaac atcccgcgcg gccgcgacat gggaccgatc       720
     gcggtctgct gggtcctggc gatgctcatc ctggtcttcg agaccgacct cggtgtctcg       780
     ctgatgttct tcggcgcgtt cgtggtgctg ctgtacatcg ccaccgaacg gacctcgtgg       840
     ctggtcttcg gcgtcaccgc gttcatcggc ggtgccgtgt tcatcgccac gacggtgccg       900
     cacgtccagg cccgcgtgaa caactggctg cacccgttca ccggcgagat ctgcgcccgt       960
     accgcggcgc ccgggacgaa ctgcccctcg gaccagatct cgcagtccat ctacggcttc      1020
     gccaccggcg gcatcttcgg caagggtctg gaccagggcc ggccctggct ggtcgggttc      1080
     gccaagaacg cggacttcat cctggtcacg gtcggcgagg agctcggcat ggtcgggctg      1140
     ttcgcgctga tgatggtcta cacgctgttc gtgatgcgcg gcttcaagac cgcgctgctg      1200
     atccgcgaca actacggcaa gctgctcgcg gctggcctgt ccgtgacgtt cgccctgcag      1260
     gtgttcatca ccgccggcgg cgtcatgcgc gtcatcccgc tgaccggtct gccgatgccg      1320
     ttcctggccg ccggcggttc ggcgctggtg gcgaactggg tcgtggtggc gctgttgatc      1380
     agattgtccg actcagcacg gcgcccgctg ccgccggcga tcccgctgac cgacgacgag      1440
     ctgcgggcga tgcggctggc ggccgctcag aagatgccgt cgaacgcggc tccggcccgg      1500
     cacgcccagc cggcggcgca gactccggcc ggcggtccgc cccggccgca cccgctggcg      1560
     cagcccgggc tcgggcagac cggcctggcg cagagcggcc tggaccagac cgggctcgac      1620
     actcccagtg gttccgagga gccggcgccg cctggggcga gcgaccccac cgaaccgatg      1680
     cccgttcgcc gcgtcgccgc ggccggtgcc ggcgcggacg acgtgacgca agccgttccc      1740
     tcccagccgc gcggttacgg cgagcagacg atgctgcgcg cagcggaggc gacccaagcg      1800
     atgcaggcca catccggccc gagagcggaa ccggaacagg gcgcgacgga gtcctatacc      1860
     ccggcgttcg aagacgaaga tgacgacgac gtgcggacgc ggccgacccc ggcgcccggg      1920
     gcgaacccgg gcgaggtgcc gggccggccg ggtccgactg agcggaggta cggaccgtga      1980
//

If you have problems or comments...

PBIL Back to PBIL home page