(data stored in ACNUC7421 zone)

EMBL: CP001700.PE360

CP001700.PE360       Location/Qualifiers
FT   CDS_pept        complement(405526..406497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0362"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sma:SAV_3810 epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69315"
FT                   /db_xref="GOA:C7PVF9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVF9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69315.1"
FT                   /translation="MNKRSVMVGGLRMNVVEAGSGPDVVVLLHGFLNYSYSWRHQVRDL
FT                   AAAGYRVLAPDLRGYGETGCPEDVEQYSMLHLVADVVGLLDAFGIERATVVGHDWGSVL
FT                   AWHTALLRPDRVRGVVGLSVPYVPRADISLLTAMRERFGDLYYMQYFQEVGPADRELAR
FT                   DVAATFRSVLSSGSEPWNPVLPEGGGWLDCLPDKGIPDWLTAADLDAHVAAFERSGFTG
FT                   ALNWYRNIDRNHELTAAWQGAKIQVPALFLYGTRDAFGRYASELIDDLPRSVPDLRSVV
FT                   RLDAGHWVQQERPDEVTAALVDFLERDRDRDGARPMPVGAAL"
     gtgaacaagc ggtcagtgat ggtcggcggg cttcggatga acgtcgtcga ggccggttcg        60
     ggaccggacg tcgtcgtgct gctgcacggg ttcttgaact actcctactc ctggcggcat       120
     caggtgcgcg acctcgccgc cgccggatac cgcgtgctcg caccggatct gcgcggatac       180
     ggcgagaccg ggtgcccgga agacgtcgag cagtattcga tgctgcactt ggtcgcggac       240
     gtggtcgggc tgctcgacgc gttcgggatc gagcgggcga cggtggtcgg gcacgactgg       300
     gggtcggtgc tcgcctggca caccgctttg ctgcggcccg atcgggtgcg gggcgtggtc       360
     gggttgagtg tgccgtacgt accgcgcgcc gatatcagcc ttctgacagc gatgcgcgag       420
     cggttcggcg atctctacta catgcagtac ttccaagagg tcgggcccgc ggaccgggag       480
     ctggctcgcg atgtcgcggc gacgttccgc agtgttctga gttcggggtc ggagccgtgg       540
     aatccggtgc tgcccgaagg cggcgggtgg ctggactgct tgccggacaa ggggattccg       600
     gactggctga ccgccgccga tctggacgcc cacgtcgccg ccttcgagcg cagcggcttc       660
     accggcgcgc tcaactggta ccggaacatc gaccgcaacc atgagctgac cgccgcatgg       720
     cagggcgcga agatccaagt gcccgcgctg ttcctctatg gaacgcgcga cgccttcgga       780
     cgttatgcgt cggagctgat cgacgatctg ccgcgctccg tgccggatct gcggagcgtc       840
     gtacgcctgg acgcggggca ctgggtccag caagagcggc cggatgaggt gaccgccgcg       900
     ttggtggact tcctggaacg cgaccgggac cgcgatggag cgcgaccgat gcctgtgggt       960
     gccgctctct ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page