(data stored in ACNUC7421 zone)

EMBL: CP001700.PE361

CP001700.PE361       Location/Qualifiers
FT   CDS_pept        407168..409477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0363"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   sgr:SGR_935 putative sensor-like histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69316"
FT                   /db_xref="GOA:C7PVG0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69316.1"
FT                   /translation="MTAADRVQEAPPRPGHGAPGRHSAYNAAGAERRPAGRRPTAWVVA
FT                   PSVCSAVLAGAAIVLVVDGAHSAGYHISSGTMTAVWVLGGLILAVVAATLAFAGRPGRA
FT                   TEIPAFGGPDPRQAPPPMAQPQPQPQPQPHQQPQHQQHRPQPAPAPLPQQAPPPPPMSP
FT                   QVVANATEAAATLAAATKAAAGPIAVSEEGVDLQVIFAQLVRRLLTLVLQQINRLDELE
FT                   NEVEDPKLLKSLFGIDHQATQVRRYGENIGVLVGALPQRQWTHPVPVTVAQRSAVSETP
FT                   DYPRVQVIPRAPGRIHGHAVSDVIHILSELVENATNYSNPTTKVTVGAHRVSAGLAIEI
FT                   NDHGIGMESDQFRRLNTLLRDPSGANVKDLLSQGRIGLSVVAKMAQRHGIAVELAPNVT
FT                   GGTMALVVIPDALLAAEELPADKGHQPRRGIDHTQLPARPALAPLPDTLPPATTSSTAS
FT                   TAATAPSSAASLSPVAASMPPPLSSPATAHVPPLPTSPAAAAQESARAGQPTPIRATPP
FT                   PLPTSPLPTSPAAADQAARTAQQGYAQPDSFQSGQGRQAWSQPAPAEPQWPSINPPVTG
FT                   GASAPTAAAPVPGPTGSVASFQAPSADMYQGSELGAAAPAQTDRYPAQDFGTPAPAQPD
FT                   RYSLQGPDTAVLPLTPDRYPAPGTGTSVPPWSRLGDRSAAGEQASEPASEKAPGLLPDG
FT                   RPQLRRRTPQGHISARLLQAEPQENPHGGGALSPTMMSDFWQGLSSGIAPAGPPAAGAD
FT                   PSQHDRTTANRQEWNQ"
     gtgaccgcgg cggaccgcgt ccaggaggcg ccgccgcgtc ccgggcacgg cgcaccgggc        60
     cggcactcgg cctacaacgc cgcgggcgcg gagcgccggc cggcgggccg acggccgacc       120
     gcctgggtcg tggctccctc ggtgtgctcg gcggtgctgg ccggcgccgc gatcgtcctc       180
     gtcgtcgacg gcgcgcactc ggccggctat cacataagca gcggcacgat gaccgccgtc       240
     tgggttctcg gcggtctgat actcgcggtc gtcgcggcca ccctcgcctt cgccgggcgt       300
     ccgggccgcg cgaccgagat ccccgccttc ggcgggcccg acccccggca ggcgccgccg       360
     ccgatggcgc agccccagcc ccagccccag ccgcagccgc accagcagcc gcagcaccag       420
     cagcaccgac cccagcccgc cccggctccg ctgccgcagc aggctccgcc gccgcccccg       480
     atgtctccgc aggtcgtcgc gaacgccacc gaggccgccg cgacgctggc cgcggcgacc       540
     aaggccgcgg ccggtccgat cgccgtctcc gaggagggcg tggacctgca ggtcatcttc       600
     gcccagctgg tccgccggct gctcaccctg gtgctgcagc agatcaaccg gctcgacgag       660
     ctggagaacg aggtcgagga ccccaagctc ctgaagtcct tgttcggcat cgaccaccag       720
     gccacccagg tccgccgcta cggcgagaac atcggggtgc tggtgggagc ccttccgcag       780
     cggcagtgga cgcacccggt cccggtcacc gtggcgcagc gctcggcggt ctccgagacc       840
     ccggactacc cccgcgtgca ggtgatcccg cgggcgccgg gccgcatcca cggccacgcc       900
     gtctccgacg tcatccacat cctgtccgag ctggtcgaga acgccaccaa ctactcgaac       960
     ccgaccacca aggtcaccgt cggcgcgcac cgggtgtccg cggggttggc gatcgagatc      1020
     aacgaccacg gcatcggcat ggagtccgac cagttccggc ggctgaacac gctgctgcgc      1080
     gacccgtcgg gggcgaatgt caaggatctg ctttcccagg gccgcatcgg cctgtccgtg      1140
     gtcgcgaaga tggcccagcg ccacgggatc gcggtcgagc tggcgccgaa cgtcaccggc      1200
     ggcaccatgg cgctcgtggt gatcccggac gcgctgctgg cggcggagga gctgcccgcg      1260
     gacaaggggc atcagccgcg ccgcggcatc gaccacacgc agctgccggc ccggccggcg      1320
     ctcgcgccgc tgccggacac ccttccgccg gccacgacct cctcgaccgc ctcgaccgct      1380
     gccacagccc cgagttcggc cgcctcgctg tccccggtcg ccgcctcgat gccgcccccg      1440
     ctgtcgtcgc cggccaccgc gcacgtcccg ccgctgccga cctcgcccgc cgccgcggcg      1500
     caggagtcag cccgcgccgg ccagccgaca ccgatccggg ccacgccgcc gccgctgccg      1560
     acgtcaccgc tgccgacctc gccggccgcc gcggaccagg ccgcccgcac cgcgcagcag      1620
     ggctacgcgc agcccgactc cttccagtcg ggccaaggcc gccaggcatg gtcccagccg      1680
     gctcccgccg agccgcagtg gccgtccatc aacccgccgg tgaccggcgg cgcctccgcg      1740
     ccgaccgccg ccgcgccggt gccgggcccc accggctccg tcgcgtcctt ccaggcgccg      1800
     tcggccgaca tgtatcaggg ctcggagtta ggcgccgcag cgccggcgca gaccgatcgg      1860
     tacccggcgc aggacttcgg gacaccggcg ccggcgcagc ccgaccggta ctcccttcag      1920
     ggcccggaca ccgccgtgct gccgctgacc cccgaccggt accccgcgcc gggtactggt      1980
     acctccgtgc cgccgtggtc ccgcctcggc gaccggtccg cggcgggcga gcaggcttcc      2040
     gagccggcgt ccgagaaggc tccgggcctg ttgcccgacg gccgtccaca gcttcgccgc      2100
     cgtaccccgc agggccacat ctccgcgcgg ctgctccagg ccgagccgca ggagaacccg      2160
     cacggcggcg gcgcgctttc cccgacgatg atgtcggact tctggcaagg cctttcctcg      2220
     ggcatcgcac cggccggccc cccggcggcc ggcgcggacc cttcgcagca cgatcgcacc      2280
     accgcgaacc gtcaggagtg gaaccagtga                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page