(data stored in ACNUC7421 zone)

EMBL: CP001700.PE362

CP001700.PE362       Location/Qualifiers
FT   CDS_pept        409474..409905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0364"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   sma:SAV_1632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69317"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG1"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACU69317.1"
FT                   /translation="MSTQTEENLSWLINRMLQSIPAARSVLLMSTDGLVRAYTTGLNKD
FT                   EADTLAAAESGMWGIVTAIGKTVRAGGVRQVVVELDGAFLCVGAAGPGTCIGVLADREA
FT                   DPRQIGFEMQRCVTAVVRELSTAPRGAADGAVAAARARS"
     gtgagcaccc agaccgaaga gaatctcagc tggctgatca accggatgct gcagagcatt        60
     ccggccgccc gcagcgtgct gttgatgtcg acggacggtt tggtccgcgc gtacacgacc       120
     ggtctgaaca aggacgaggc cgacaccctg gccgccgccg agagcgggat gtggggcatc       180
     gtcaccgcca tcggcaagac ggtccgggcc ggcggcgtcc gccaggtggt ggtggagttg       240
     gacggcgcgt tcctgtgcgt cggcgccgcc ggtcccggca cctgcatcgg cgtgctggcc       300
     gaccgcgagg ccgacccgcg gcagatcggc ttcgagatgc agcgctgcgt caccgccgtg       360
     gtccgggaac tgtccacggc tccccgcggc gccgcggacg gcgcggtggc agcggcccgg       420
     gcccggtcgt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page