(data stored in ACNUC7421 zone)

EMBL: CP001700.PE363

CP001700.PE363       Location/Qualifiers
FT   CDS_pept        409902..410273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0365"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742; KEGG:
FT                   sco:SCO6796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69318"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG2"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ACU69318.1"
FT                   /translation="MSRGDPDAFVDSAAGRLIRPYAVAGGRTAPNADFHLVTYVVATGR
FT                   ALSDLGPDHDDILSLCDRPISVAEVSALSGLPLAVTKILLSDLLGWRAIDTRAPVPVFE
FT                   RARPSTDLLEKVLDALYKL"
     gtgagccggg gcgatcccga tgccttcgtc gactccgcgg ccggccgcct catccggccg        60
     tacgcggtcg ccggcggccg gaccgcgccg aacgccgact tccacctggt gacctacgtg       120
     gtggccaccg gccgggccct gagcgacctg ggcccggacc acgacgacat cctgagcctg       180
     tgcgaccgcc cgatctcggt cgccgaggtc tcggcgctgt ccgggctgcc gctggcagtg       240
     accaagatcc tgctgtccga cctgctcggc tggcgcgcca tcgacacccg cgcgccggtg       300
     cccgtcttcg aacgggcgcg gccgagcaca gaccttctgg agaaggtgct ggatgccctc       360
     tacaagctct ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page