(data stored in ACNUC7421 zone)

EMBL: CP001700.PE364

CP001700.PE364       Location/Qualifiers
FT   CDS_pept        410254..410889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0366"
FT                   /product="protein of unknown function ATP binding"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   tfu:Tfu_2447 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69319"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG3"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ACU69319.1"
FT                   /translation="MPSTSSDRASENLPGGLKLLIAGGFGVGKTTLVGAVSEIAPLKTE
FT                   ATITEASVGVDDIALTGGKTTTTVALDFGRISIANEYVLFLFGMPGQERFWFMWDQLCI
FT                   GALGVIVLVDTRRIEDSFEAVDYFERTGIPFLVAVNEFEGARFAYTSVEVREALQLRAE
FT                   VPVVMCDARSRTSAVNVLIALVKHLQSTDFRPVRPAAPELAAHEGSYI"
     atgccctcta caagctctga ccgcgcctcc gagaatcttc ccggcggcct caagctgctg        60
     atagccggcg gcttcggcgt cggcaagacc acgctggtcg gggcggtctc cgagatcgcg       120
     ccgctgaaga ccgaggcgac gatcaccgag gcctccgtcg gcgtcgacga catcgcgctg       180
     accggcggca agaccaccac cacggtcgcg ctggacttcg gccggatcag catcgccaac       240
     gaatacgtgc tgttcctgtt cgggatgccc ggccaggagc ggttctggtt catgtgggac       300
     cagctgtgca tcggggccct cggggtgatc gtgctggtcg acacccggcg catcgaggac       360
     tccttcgagg ccgtggacta cttcgagcgc accgggatcc cgttcctggt cgcggtcaac       420
     gagttcgaag gcgcgcggtt cgcctacacc tccgtggaag tgcgcgaggc gctccagctg       480
     cgcgccgagg tgccggtggt gatgtgcgac gcccgctcgc gcacctcggc cgtgaacgtg       540
     ctcatcgcgc tggtgaagca cctgcagagc accgactttc ggcccgtccg gcccgccgcc       600
     cccgagctgg ccgcgcatga aggaagctac atatga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page