(data stored in ACNUC7421 zone)

EMBL: CP001700.PE365

CP001700.PE365       Location/Qualifiers
FT   CDS_pept        410886..411854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0367"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; SMART: GAF domain protein;
FT                   KEGG: sma:SAV_1629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69320"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG4"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ACU69320.1"
FT                   /translation="MTDRDDFQTPALRLGQPAPSDAAARAARQRELSLSATADSVFDEV
FT                   ARRAAEATGATAAMVNMVGENGQYLVGLYGKEPGSGEAAFLGDPGRYAAMDQGFCVHVV
FT                   GRKAALTLDDVFDFSRFRGNPIVDELGVRSYIGVPLIDDGGTVIGTVCAIDPAPRSESD
FT                   GNSWGNQGLQVLKAARDEVLAEISGRQKIAAILENAGGTAMIAARPGLEVLYANTLHDQ
FT                   LFGAVQVLGTPALEAFPHLAPVGILAVIETLDRGGEPTTTAPIPLSEPATGSVIFAAVP
FT                   VRVPGHASAVLTLGLRDSDAATVLNRAAQIAADIGALSDTR"
     atgacagacc gcgacgactt ccagaccccg gccctgcggc tggggcagcc ggcgccctcg        60
     gacgccgccg cgcgcgcggc gcgccagcgg gagctgagcc tgtccgccac ggcggactcg       120
     gtcttcgacg aggtcgcgcg ccgggccgcc gaggccaccg gcgccaccgc ggcgatggtc       180
     aacatggtcg gcgagaacgg ccagtacctg gtggggctgt acggcaagga gccgggcagc       240
     ggcgaggcgg cgttcctggg cgaccccggc cgctacgcgg ccatggacca gggcttctgc       300
     gtgcacgtcg tgggccgcaa ggccgcgctg accctggacg acgtcttcga cttctcccgg       360
     ttccgcggca acccgatcgt cgacgagctc ggggtccgca gctacatcgg cgtgccgctg       420
     atcgacgacg gcggcacggt gatcggcacg gtgtgcgcga tcgacccggc gccgcgcagc       480
     gaatccgacg gcaactcctg ggggaatcag ggccttcagg tcctcaaggc cgcgcgcgac       540
     gaggtcctgg ccgagatcag cggtcggcag aagatcgccg ccatcctgga gaacgccggc       600
     ggcacggcga tgatcgcggc gcgtccggga ctggaggtgc tgtacgcgaa cacgctgcac       660
     gatcagctct tcggcgccgt ccaggtactc ggcacacccg ccctcgaggc cttcccgcac       720
     ctggcgccgg tcggcatcct ggccgtcatc gagaccctcg accgcggcgg cgagccgacg       780
     accaccgcgc cgatcccgct gagcgagccc gccaccggct cggtgatctt cgccgcggtc       840
     ccggtccggg tacccggcca cgcctcggcg gtgctcaccc tcgggctgcg ggacagcgac       900
     gcggcgaccg tgctgaaccg ggccgcgcag atcgccgcgg acatcggggc gctcagcgac       960
     accaggtga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page