(data stored in ACNUC7421 zone)

EMBL: CP001700.PE366

CP001700.PE366       Location/Qualifiers
FT   CDS_pept        complement(411918..412919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0368"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="KEGG: sma:SAV_609 3-oxoacyl-(acyl carrier protein)
FT                   synthase III; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; 3-Oxoacyl-[acyl-carrier-
FT                   protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69321"
FT                   /db_xref="GOA:C7PVG5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG5"
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /protein_id="ACU69321.1"
FT                   /translation="MTKAAVISGIGSSVPASVVTNDMLAERLDTTDDWIRRLTGIQTRH
FT                   WIEPGQATSDLAVEAGSRAIESAGGEPPQAVVLATITPDRPCPATAPEVASRLGLEGVA
FT                   AFDVAAVCSGFVYGLATGTGLIAAGIAERVLVIGADTISTILDPTDRSTGVIFGDGAGA
FT                   VMLRAGEADEPGALQALDLGSDGTGTDLITVPAGGSRQRSTKSVPPTTDTYLKMAGREV
FT                   FRESVRRMVESCEAVLERTGWDAADVDRLVPHQANLRIMNSVADRLGMPRDRAVVDLDR
FT                   VGNTSAASIPLALARAAAEGTVESGHRLLLTAFGGGLTWGSATLTWPDIKPV"
     atgacaaagg ccgcagtcat ctcaggaatc ggctcgagcg tgccggcctc ggtggtcacc        60
     aacgacatgc tcgccgagcg gctggacacg accgacgact ggatccgcag gctcaccggc       120
     atccagacca ggcactggat cgagcccggg caggcgacgt cggatctggc ggtggaagcc       180
     gggtcgcgcg cgatcgaatc cgccggcgga gagccgccgc aggctgtggt gttggccaca       240
     atcaccccgg accggccgtg cccggcgacc gctccggagg tcgcctcgcg cctgggcttg       300
     gaaggtgtcg cagccttcga tgtcgccgcc gtgtgctcgg gcttcgtgta cgggctggcg       360
     accggtaccg gactgatcgc cgccgggatc gccgaacgcg tcctggtgat cggcgcggac       420
     acgatcagca cgatcctgga tcccaccgac cgctccacgg gcgtcatctt cggcgacggc       480
     gccggggccg tgatgctgcg ggccggcgag gcggacgagc cgggcgcgct gcaggcgctg       540
     gatctgggca gcgacggcac cggcacggac ctgatcaccg tcccggcggg cggatcccgg       600
     cagcggtcca ccaagtcggt cccgccgacg acggacacct acctcaaaat ggcgggccga       660
     gaggtgttcc gcgagtcggt ccggcgcatg gtcgaatcct gtgaggccgt cctcgagcgg       720
     accggctggg acgcggcgga cgtcgaccgg ctggttccgc accaggcgaa tctccgcatc       780
     atgaacagtg tggcggaccg gctgggcatg ccccgcgacc gcgcggtcgt cgacctcgac       840
     cgcgtcggca acacctcggc tgcctcgatt ccgctcgcgc tggcgcgggc ggcggccgag       900
     ggcaccgtcg aaagcggcca caggctcctg ctgaccgcct tcggcggcgg cctgacctgg       960
     gggtcggcca cgctgacatg gcccgacatc aagccggtct ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page