(data stored in ACNUC7421 zone)

EMBL: CP001700.PE367

CP001700.PE367       Location/Qualifiers
FT   CDS_pept        complement(412969..413247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0369"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: sco:SCO0549
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69322"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG6"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ACU69322.1"
FT                   /translation="MESYQHVLDTLRVIIEGSVDEVAAGDITADSDLAGELGVDSLAMF
FT                   EIADKAQERWNIKISDDDISRFTTVESLATFIQAAVGAQGLPAMTEA"
     atggaatcgt accagcatgt cctcgacact cttcgcgtca tcatcgaggg atctgtcgat        60
     gaagtggccg ccggtgacat caccgcggac agtgatctcg caggcgagct cggagtcgac       120
     tccctcgcca tgttcgagat cgcggacaag gcgcaggagc gatggaatat aaagatctcc       180
     gacgacgaca taagtcgatt caccaccgtg gaaagcttgg cgaccttcat ccaggccgcg       240
     gtgggggcgc agggactgcc cgcgatgaca gaagcctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page