(data stored in ACNUC7421 zone)

EMBL: CP001700.PE368

CP001700.PE368       Location/Qualifiers
FT   CDS_pept        complement(413303..414853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0370"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: npu:Npun_R2083
FT                   AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69323"
FT                   /db_xref="GOA:C7PVG7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU69323.1"
FT                   /translation="MTADGMIAFLRQYADDRLDSWLMDERRSLPLSLISHLGSEGLFGL
FT                   RVDRRYGGRELSHTDTFRVIRQAAAIDPNLAVLLAVHNSLGIPPVRDYADEETKQRVLP
FT                   TLATGRGLVTVASSEPGMGSNVVRGMATTAIRQADRSFIVNGKKSWISLGAASSHITVL
FT                   ARLQEPNGRRRGITAFLLPTSTPGFRPRSEAMTIGLRAVPQDHITLDNMRLPPSAVLGA
FT                   EGGGAALAQNSFRMGRAFLAASGTGAMQRCIQLAERFAGRRGISTGRLLDNGVTQRILA
FT                   DCAAATRTVEALVFSLAERLDRGGPVPDEFFFACKVIGCELAGQVVDQCVQLMGARGFV
FT                   DTDIVGKYFRDFRVLRIFEGATEAMSVFVGTRIVRDLESFHTTMVKTFGATKLESDLMA
FT                   GLHDLVERAGSGLTPQQGHVLARAVGDVACWGVTAAAIAETAENSHGDLDVYAAYWAAR
FT                   QLEQRLASARNELRPAFALSANVLARHIAEYADSIGDTQQSYGGERRAVDAFLHRDPA"
     atgacggccg acggcatgat tgcgtttctc cgtcagtatg cagatgaccg tctcgattca        60
     tggctcatgg acgaacgccg ttccctgccg ctgtcgctga tatcccatct gggcagcgag       120
     ggcttgttcg gactgcgggt ggaccggagg tacggagggc gggaactctc ccacaccgat       180
     acgttccggg tgattcggca ggccgccgcg atcgatccca atctcgccgt gctgctggcc       240
     gtccacaact ccctcgggat accgccggtc cgggactacg ccgacgagga gaccaagcaa       300
     cgcgttctgc cgaccttggc gaccgggcgc ggactggtca ccgtcgccag cagcgaaccg       360
     ggtatgggat cgaacgtggt ccgcgggatg gccaccaccg cgatccgcca agccgaccgg       420
     agcttcatcg tcaatggcaa gaagtcgtgg atcagcctcg gtgccgcgtc gagccacatc       480
     acggtgctcg cccgacttca ggagcccaac ggccggcgaa ggggcataac cgcctttctc       540
     cttccgacat ccacgcccgg gttccgtccc cgcagcgagg cgatgacgat cggcctcaga       600
     gccgtccccc aggaccacat cacccttgac aacatgcgtc tacccccctc ggcagtactg       660
     ggagcggagg gcggcggggc agcgctggcc cagaactcgt tccggatggg acgcgccttc       720
     ctcgccgcat cgggcaccgg ggcgatgcag cggtgcatcc agctcgccga acgattcgcc       780
     ggccggcgcg gcatttccac gggcaggctt ctcgacaacg gcgtcaccca gcggattctg       840
     gcggactgcg ccgcggcgac acgcaccgtg gaagcgctcg tgttctccct cgccgagcgg       900
     ctggaccgcg ggggaccggt gcccgacgag ttcttcttcg cctgcaaggt catcggctgt       960
     gagctggcgg gccaggtcgt cgaccagtgc gtgcagctga tgggcgcgcg aggcttcgtc      1020
     gacaccgaca tcgtcggcaa atacttccgg gacttccggg ttctgcgcat cttcgaaggc      1080
     gccaccgagg ccatgtcggt cttcgtcggg acgcgcatcg tgcgcgatct ggagtccttc      1140
     cacaccacga tggtgaagac cttcggcgcc acgaagttgg agagcgacct catggccggc      1200
     ctgcacgatc tggtcgagcg ggcgggcagc ggcctcaccc ctcaacaggg ccacgtgctc      1260
     gcgcgcgcgg tgggcgatgt ggcgtgttgg ggtgtgaccg ccgcggcgat cgccgagacg      1320
     gcggagaaca gtcacgggga cctcgacgtc tacgcggcct attgggccgc ccggcaactc      1380
     gagcagcgct tggcctccgc gcgcaacgaa ttacgtcctg ctttcgcgtt gtccgccaac      1440
     gtcttggcgc ggcacatcgc cgaatacgca gattccatcg gggacacaca gcagagttac      1500
     ggcggcgaac gccgcgccgt cgacgccttc cttcaccgtg atcccgcata g               1551
//

If you have problems or comments...

PBIL Back to PBIL home page