(data stored in ACNUC7421 zone)

EMBL: CP001700.PE369

CP001700.PE369       Location/Qualifiers
FT   CDS_pept        complement(414952..415155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69324"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69324.1"
FT                   /translation="MPCKTASAILLTPTMNAPILFDVNETAAHQPSAERHGANGGHDHT
FT                   GVRILKPVRSCHACEKSSKLVG"
     atgccttgca aaaccgcctc ggccatcttg ttgacgccga cgatgaacgc gcccatcttg        60
     ttcgatgtga acgaaaccgc cgcgcaccag ccgagcgccg aacggcacgg ggcgaacgga       120
     gggcacgatc acaccggcgt gcggatcttg aagccggtgc ggtcttgcca cgcgtgtgag       180
     aagtcttcta agctcgtagg gtaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page