(data stored in ACNUC7421 zone)

EMBL: CP001700.PE37

CP001700.PE37        Location/Qualifiers
FT   CDS_pept        38758..40230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0037"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: sma:SAV_4339 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68992"
FT                   /db_xref="GOA:C7QFQ3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ3"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACU68992.1"
FT                   /translation="MNQPIRRVAIFCFLLIASLLVSSNYLQVVNADSYKARAGNQRTEL
FT                   DYYAYPRGKILTADGTVIADSVPSGGLQYKYQRTYPLKADYANITGWKSIVYGSRDIEN
FT                   VLDKYLQGTDSSESVANFMDTLTGKSKKGGDVQLTLQNAVQQAAIKGLGKQNGSVVALD
FT                   PTTGAILAMYSSPSFDPNGIASNVSETSTAAGNALEADKGKPNLNHAIGENYPPGSVFK
FT                   IVTAAAALDSGKFTETGSTGADPNFYSNGSGYKLKNEDGTCSGTDLKTALAESCNSVYG
FT                   FVGATLGSQIMSTYASKFGFNDPSLKIPLQVAQSNFPSPATVGTNVLGLAQDSIGQGDT
FT                   QVTPLQAAMIAAAVANGGTIMQPYMVDKETAPNGHVTYKGSDHQHELSQAMSPATAATL
FT                   DDMMQNVVTHGTAQGRGIPGVQMGAKTGTAQRASGQNPLAWFVCYGTANGKKVAVAVMV
FT                   DTNDPSIRSDVSGVNFAGPTAQAVLKAALGVG"
     gtgaaccagc cgatcaggcg ggtggcgatc ttctgcttcc tgctcatcgc cagcctgctg        60
     gtcagctcca actacctgca ggtggtcaac gccgacagct acaaggcgcg ggccggcaat       120
     cagcgcaccg agctggacta ctacgcctat ccgcggggca agatcctcac cgcggacggc       180
     accgtcatcg cggactcggt tccctccggc ggtctgcagt acaagtacca gcgcacgtat       240
     ccgctgaagg ccgactacgc caacatcacc ggctggaagt cgatcgtcta cggctccagg       300
     gacatcgaga acgtcctcga caagtacctg cagggcaccg acagttcgga gtcggtcgcc       360
     aacttcatgg acacgctgac cggcaagtcc aagaaggggg gcgacgtcca gctgaccttg       420
     cagaacgcgg tgcagcaggc cgcgatcaag gggctgggca agcagaacgg ctcggtcgtg       480
     gccctggacc cgaccaccgg cgcgatcctg gcgatgtact ccagcccgag cttcgacccg       540
     aacgggatag cctccaacgt cagcgagacc tcgaccgccg cgggcaacgc gctggaggcg       600
     gacaagggca agccgaacct gaaccacgcg atcggggaga actacccgcc cggctcggtg       660
     ttcaagatcg tcacggcggc cgcggcgctg gactccggga agttcaccga gaccggctcg       720
     accggcgcgg accccaactt ctactcgaac ggctccggct acaagctgaa gaacgaggac       780
     ggcacctgct cgggcaccga cctgaagaca gcgctggccg agtcctgcaa ctccgtctac       840
     ggcttcgtcg gggccacgct cggctcgcag atcatgtcca cctacgcctc gaagttcggc       900
     ttcaacgacc cgagcctgaa gatcccgctg caggtggcgc agtcgaactt cccctcgccc       960
     gccaccgtgg gcaccaacgt gctgggtctg gcccaggact cgatcggcca gggcgacacc      1020
     caggtgaccc cgctgcaggc ggcgatgata gcggccgcgg tggccaacgg cggcacgatc      1080
     atgcagccct acatggtgga caaggagacc gcgcccaacg ggcacgtcac ctacaagggg      1140
     tcggaccacc agcacgagct cagccaggcg atgagcccgg cgaccgcggc gaccctggat      1200
     gacatgatgc agaacgtcgt cactcacggc accgcccagg gcagggggat ccccggcgtc      1260
     cagatgggcg ccaagaccgg tacggcgcag cgggcctcgg gccagaaccc gctggcgtgg      1320
     ttcgtctgct acggcaccgc caacggcaag aaggtcgcgg tggccgtgat ggtcgacacc      1380
     aacgacccca gcatccgcag cgacgtcagc ggtgtgaact tcgccggccc gacggcgcag      1440
     gcggtgttga aggcggcgct cggcgtgggc tag                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page