(data stored in ACNUC7421 zone)

EMBL: CP001700.PE370

CP001700.PE370       Location/Qualifiers
FT   CDS_pept        complement(415643..416230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69325"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69325.1"
FT                   /translation="MSAPPVLRDVYRTLMAARGDAAASLTFDDGPGPIARLDVFVYRPA
FT                   EPAGLTTFATVGMATAPMPTADGAEGSRAELLLSRSGELAPEDEQQIAMQLANLAVYPW
FT                   KTGRAVGWAQIVGFEQDFPTFPGCPAVFLAGPLLKDTPNWIDTCEGAVQVITVVPITEA
FT                   ERASAASMPPKTFAGNLIEARDVFTAPPVVGA"
     atgtctgctc ccccggtcct gcgcgacgtt tacagaaccc tgatggcagc gcgcggcgac        60
     gcggccgcct cgctcacgtt cgacgacggc ccgggcccga tcgcccgcct cgacgtcttc       120
     gtctaccggc ccgccgaacc cgccggcctc accacgttcg cgacggtcgg gatggccacc       180
     gcgccgatgc ccacggcgga cggcgcggag ggcagccgcg cagagctgct gctgtcccgc       240
     tccggcgagc tggcgccaga ggacgagcag cagatcgcca tgcagctggc gaatctggcc       300
     gtgtacccgt ggaagaccgg ccgcgcagtc ggctgggcgc agatcgtcgg attcgagcag       360
     gacttcccga ccttcccagg ctgccccgcg gtgttcctcg ccggcccgct gctgaaggac       420
     acccccaact ggatcgacac ctgcgagggc gcggtccagg tgataaccgt cgtaccgatc       480
     acggaggcgg agcgggcctc cgccgcgtcc atgccgccga agacgttcgc gggcaatctg       540
     atcgaggcgc gcgatgtgtt cacagcgccg cctgtggtgg gcgcctga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page