(data stored in ACNUC7421 zone)

EMBL: CP001700.PE371

CP001700.PE371       Location/Qualifiers
FT   CDS_pept        416438..418825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0373"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   Fibronectin type III domain protein; SMART: Fibronectin
FT                   type III domain protein; coagulation factor 5/8 type domain
FT                   protein; KEGG: sco:SCO7015 secreted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69326"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH0"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ACU69326.1"
FT                   /translation="MTVTRRRFLTTAAAGSAAALLAGPDLLAAPAARAASPAGDVVGKI
FT                   TVGYQGWFACAGDGAPIGGWWHWAQNWAQTPSPSNNVIKAWPDMREYTHAYQTAYSNLG
FT                   NGQPATLFSSYDQQTVDTHFLWMQQNGCDTAALQRFNPNSSEGPTRDAMATKVRSSAET
FT                   HSRKFYIMYDVTGWTAMQAEIKADWTSKMSALTASSAYAHQNGKPVVGIWGFGFNDANH
FT                   PWDAATCLDVITWFKSQGCYVMGGVPREWRTGTGGSRAGYLGVYHAFDMLSPWMVGAIG
FT                   TAADSDNAYTNLTVPDLADCTANNVDYQPCVLPGDLSGRQRVHGDFMWRQFYNMARAGT
FT                   QSVYISMFDEYGEGNQIAKTAENQSMSPNGAGLLALDEDGTACSSDYYLRLTADGGRML
FT                   KGQIPLTATRPTQPVAGSGGGSGNLALGKPASASGTSQNFGPGNAVDGDPNTYWESVNN
FT                   AFPQWFQVDLGSVAAVGSVVMKLPASWGARTQTLALAGSSDGSTFSTLAASAGRTFDPA
FT                   TGNTVTINVGTASVRYLRATFTANTGWPAGQLSEFQVFAPTSGGGGDTTPPTAPTNLAV
FT                   TGHTSSSVSLSWTASTDNIGVTGYQVRVNGTTALTVTKTTATVTGLSPSTAYSFAVVAT
FT                   DALGNVSLPSATVSATTDPATNANLALGKPTSESGHTQSYASSNTVDGDANTYWESVDN
FT                   AFPQWLMVDLGAVTSVSRVVLKLPPATAWAARTQTVAVTGGADASAASTLSASAGRLFD
FT                   PATGNSVTITFPATSVRYVRLTFTANTGWPAGQISEFQVYAS"
     atgacggtca cacgccgaag attcctcacc accgccgcgg ccggctcggc cgcggcgctc        60
     ctcgcgggcc cggacctgct cgccgcgccg gcggcgcgcg cggccagccc ggccggcgac       120
     gtcgtcggca agatcacggt gggctaccag ggctggttcg cctgcgccgg cgatggggcg       180
     ccgatcggcg gctggtggca ctgggcccag aactgggcgc agacgccgtc gccgtccaac       240
     aacgtcatca aggcctggcc ggacatgcgc gagtacacgc acgcgtatca gaccgcgtac       300
     tccaacctcg gcaacggcca gccggcgacg ctgttctcgt cctacgacca gcagaccgtc       360
     gacacccact tcctgtggat gcagcagaac ggctgcgaca ctgcggccct gcagcgcttc       420
     aacccgaaca gctccgaggg cccgacccgc gacgcgatgg cgacgaaggt gcgctcgtcc       480
     gccgagaccc acagccgcaa gttctacatc atgtacgacg tcaccggctg gaccgcgatg       540
     caggcggaga tcaaggccga ctggaccagc aagatgtcgg cgctgaccgc ctccagcgcc       600
     tacgcgcacc agaacggcaa gccggtggtg ggcatctggg gcttcggctt caacgacgcc       660
     aaccacccct gggacgccgc gacgtgcctg gacgtgatca cctggttcaa gagtcagggc       720
     tgttacgtga tgggcggcgt gccgcgtgag tggcgcaccg gcaccggtgg ctcgcgcgcc       780
     ggctacctcg gcgtctacca cgccttcgac atgctctcgc cgtggatggt cggcgcgatc       840
     ggcaccgccg ccgactccga caacgcctat accaacctca ccgtgccgga cctcgcggac       900
     tgcaccgcca acaacgtcga ctaccagccg tgcgtcctgc ccggcgacct gtcggggcgg       960
     cagcgcgtcc acggcgactt catgtggcgg cagttctaca acatggcgcg cgccgggacg      1020
     cagagcgttt acatctccat gttcgacgag tacggcgagg gcaaccagat cgccaagacc      1080
     gcggagaacc agtcgatgtc gccgaacggc gccggcctgc tggcgctgga cgaggacggg      1140
     accgcgtgct cctcggacta ctacctgcgg ctcaccgccg acggcggccg gatgctgaag      1200
     gggcagatcc cgctgaccgc gacccgcccg acgcagccgg tcgccggctc cggcggggga      1260
     tcgggcaacc tggcgctcgg caaaccggcc tccgccagcg ggacctcaca gaacttcggg      1320
     ccggggaacg ccgtcgacgg cgacccgaac acgtactggg agagcgtcaa caacgccttc      1380
     ccgcagtggt tccaggtcga tctgggctcg gtggcggcgg tcggctcggt ggtcatgaag      1440
     ttgcccgctt cgtggggcgc ccgcacgcag acgctggccc tggcgggcag cagcgacggc      1500
     agcaccttca gcacgctcgc ggcatccgcg ggccgcacct tcgatccggc gacgggcaac      1560
     acggtgacga tcaacgtcgg taccgcatcc gtgcgctatc tgcgtgccac cttcacggcg      1620
     aacaccggct ggcccgccgg acagctctca gaattccagg tcttcgcgcc gaccagcggc      1680
     ggcggtggcg acaccacgcc gcccaccgct ccgaccaacc tcgccgtcac cggtcacacg      1740
     tcgagcagcg tgtcgctgtc ctggaccgcg tcgactgaca acatcggcgt caccgggtac      1800
     caggtgcggg tgaacggcac gacggcgctg accgtgacca agacgacggc gactgtcacc      1860
     ggtctttcgc cgtccacggc ctacagcttc gccgtcgtcg cgaccgacgc cctcgggaac      1920
     gtgtcgctgc cctctgcgac agtgtcggcg acgacggacc ccgccacgaa cgccaacctg      1980
     gcgctcggga agccgacctc cgagagcggt cacacgcaga gctacgcctc gtcgaacacc      2040
     gtggacggcg acgcgaacac ctactgggag agcgtggaca acgcgttccc gcagtggctg      2100
     atggtcgatc tcggcgcggt gacatcggta tcccgggtcg tgctgaagct cccgcccgcg      2160
     accgcttggg cggcccgcac ccagaccgtg gcggtcaccg gaggcgcaga cgccagcgcc      2220
     gcctcgacac tgtccgcctc cgccggccgc ctcttcgacc cggcaaccgg caacagtgtg      2280
     acgatcacgt tcccggcgac gagcgtgcgc tacgtccggc tcaccttcac cgcgaacacc      2340
     ggatggcccg ccggccagat atcggagttc caggtctacg cgagctag                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page