(data stored in ACNUC7421 zone)

EMBL: CP001700.PE372

CP001700.PE372       Location/Qualifiers
FT   CDS_pept        complement(418891..419883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0374"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: fal:FRAAL3598
FT                   LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69327"
FT                   /db_xref="GOA:C7PVH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACU69327.1"
FT                   /translation="MDLDLAQVRAFVAAAERLHFGQAAEQLAVSQQALSKRIARLEGEL
FT                   GVQLFLRGGHAVELTDAGRRFLEPARQTLAHGDAAVAAARHVERPLRIDYWGHLFAPMR
FT                   TLAPVIERVGGAVTVETGPGRDLPGVLDALDRSATDVGFGRVHGVGGGVGSGGGGTRDA
FT                   AYTHRLVRLEPVDVVISEDHRLAGQSEVRPAELRDSVLWCPAALNRLDFFQRFAEHFDI
FT                   TAESGTANLGIDRFLEQVAADPVRFALIPADLELPERTRVRSLPLVEPTPLYAWSLVWR
FT                   AADPHPGIEPLLRAFADVAGRSRWLEYQPGRDWLPAGDVSEVWHPAERK"
     atggatcttg atctggcgca ggtgcgggcg ttcgtcgcgg cggcggagcg gctgcacttc        60
     gggcaggccg ccgagcagct cgcggtgagc cagcaggcgc tgtccaagcg gatcgcccgg       120
     ctggagggcg agctcggcgt gcagctgttc ctgcgcggcg ggcacgcggt cgagctgacc       180
     gacgccggcc gccgcttcct ggagccggcg cgccagacgc tggcgcacgg cgacgccgcc       240
     gtggcggcgg cgcgccacgt cgagcggccg ctgcggatcg actactgggg tcacctgttc       300
     gcgccgatgc ggacgctcgc gccggtcatc gagcgcgtcg ggggcgcggt gacagtggag       360
     accgggcccg ggcgcgacct gccgggcgtg ctggacgcgt tggatcggag cgccacggat       420
     gtcggcttcg ggcgtgtgca cggggtcggc ggcggggtcg gcagcggggg cggcggaact       480
     cgggacgcgg cgtacacgca tcgcttggta cgcctggagc cggtagacgt ggtgatcagt       540
     gaagatcatc ggctcgccgg ccagtcggag gtacggcctg cggagctgcg cgacagcgtt       600
     ctgtggtgtc ccgcggcgct gaaccggctg gacttctttc agcgcttcgc agagcacttc       660
     gacatcactg ccgagtccgg cacggcgaat ctcggcatcg accgcttcct ggagcaggtg       720
     gcggccgatc cggtgcgctt cgcgctgatc ccggcagatc tggagctgcc ggaacgtacc       780
     cgcgtccggt cactccccct cgtcgagccc acgccgctct atgcgtggtc gctggtctgg       840
     cgggcagcgg atccgcatcc gggcatcgag cccctcctgc gagccttcgc cgacgtcgca       900
     ggccgaagcc gatggctgga gtaccaaccg ggtcgcgact ggctgcccgc cggcgacgta       960
     tcagaggtct ggcatcccgc agagcgcaag tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page