(data stored in ACNUC7421 zone)

EMBL: CP001700.PE373

CP001700.PE373       Location/Qualifiers
FT   CDS_pept        420005..420925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0375"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mlr3236 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69328"
FT                   /db_xref="GOA:C7PVH2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH2"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU69328.1"
FT                   /translation="MKAMTATGRTEPSVALTAVDQPQPRPDEALVKVEAYSVNRGETFQ
FT                   LEAPRPGWRPGKDVAGLVVQAAADGSGPAVGARVVGHPPQGGWAEYVAVPTSSLADLPD
FT                   TVPAATAAALPLAGLTALRLLRVTRAAAGSRVLMTGASGGVGHYFVELAAAAGLEITAV
FT                   SSSPERGARLLELGAARVVPSIDAAEGPFDIVLESTGGPNLPAALAKLARRGTLIWFGQ
FT                   ASRQPATLDFFDFFAGPESATIRHFHYADSDSTYGQDLQTLVRLVAADRLHPEIGLVTD
FT                   WTGTADVLTLLRDRGVRGNAVLTIA"
     atgaaggcca tgacagccac cggccgcacc gaaccgtccg tcgcactcac cgcggtggac        60
     cagccgcagc cgcgtccgga cgaggcgctg gtgaaggtgg aggcgtactc cgtcaaccgc       120
     ggcgagacct tccaactcga ggcgccgcgc cccggctggc gccccggcaa ggacgtcgcg       180
     ggcctcgtgg tccaggccgc ggccgacggc tccggcccgg cggtcggcgc ccgcgtcgtc       240
     ggccacccgc cgcagggcgg ctgggccgag tacgtggcag tcccgaccag ctctctggcc       300
     gacctccccg acaccgtccc cgccgccacc gccgccgcgc tgccgctggc cgggctcacc       360
     gcgctccgcc tcctgcgggt gacgcgagcc gccgccggca gcagggtcct gatgaccggc       420
     gcgtccggcg gcgtgggcca ctacttcgtg gaactcgcgg cggcggccgg gctggagatc       480
     accgcggtca gctcctcgcc cgaacgcggc gcccggctgc tggagctcgg cgcggcgcgc       540
     gtcgtgccct cgatcgacgc agccgaggga cctttcgaca tcgtcctgga atccaccggc       600
     ggcccgaacc tgccggccgc cctggccaag ctcgcccggc gcggaacgct gatctggttc       660
     ggccaggcca gccggcagcc ggcaacgctc gacttcttcg acttcttcgc cggtcccgag       720
     tccgccacga tccggcactt ccactacgcc gactccgact cgacctacgg acaagacctg       780
     cagacgttgg tacgcctcgt cgccgccgac cgcctgcacc cggagatcgg gctggtgacg       840
     gactggaccg ggaccgccga cgtcctgact ctcctgcgcg atcgaggagt acgcggcaac       900
     gcagtcctca ccatcgcctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page