(data stored in ACNUC7421 zone)

EMBL: CP001700.PE374

CP001700.PE374       Location/Qualifiers
FT   CDS_pept        420994..421407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0376"
FT                   /product="Limonene-12-epoxide hydrolase"
FT                   /note="PFAM: Limonene-12-epoxide hydrolase; KEGG:
FT                   fal:FRAAL3597 delta-5-3-ketosteroid isomerase- like protein
FT                   (fragment) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69329"
FT                   /db_xref="GOA:C7PVH3"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH3"
FT                   /inference="protein motif:PFAM:PF07858"
FT                   /protein_id="ACU69329.1"
FT                   /translation="MTTITDPKTVVVRYVEAVRDGDTETIVASFAEHATWLYPGNLPIS
FT                   RLWEGRDAIINDFLGGMGAYLDTSAPVVIALVHAFADGDQVLAEWTSKATAANGATYDN
FT                   RCAAVFTVEDGKITSVREYADTHHVAAVLFGEA"
     atgaccacca tcaccgaccc gaagaccgtc gtcgtccgct acgtcgaggc agtccgcgac        60
     ggcgacaccg agaccatcgt cgccagcttc gccgagcacg ccacctggct ctaccccggc       120
     aacctcccga tctcgcgcct gtgggagggc cgcgacgcga tcatcaacga cttcctcggc       180
     ggcatgggcg cctacctgga cacctcggcg ccggtcgtga tcgccctggt ccacgccttc       240
     gccgacggcg accaggtgct ggcggagtgg acgtcgaagg cgaccgccgc caacggcgcg       300
     acctacgaca accgctgcgc ggcggtcttc accgtcgagg acgggaagat cacgtcggtc       360
     cgggagtacg cggacacgca ccacgtcgcc gccgtgctct tcggcgaggc ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page