(data stored in ACNUC7421 zone)

EMBL: CP001700.PE375

CP001700.PE375       Location/Qualifiers
FT   CDS_pept        complement(421534..422022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0377"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sen:SACE_5162 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69330"
FT                   /db_xref="GOA:C7PVH4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU69330.1"
FT                   /translation="MMDGMTTTDAWTARRATVREPDAIDLLVSYYDELVSRYWGRPCEP
FT                   GEVDAAMRDEPNDDLVAFLVASVGEEPAGCVGVRMLAPEVAELSRMYIRPQFRRSGGGR
FT                   LLLGEADRAAAELGARAIRLDTRGDLVEARAMYARYGYREIPAYNDSKYANHWFEKTL"
     atgatggacg gcatgacgac gacggacgcg tggacggcgc gccgcgccac ggtgcgggaa        60
     ccggacgcga tcgatctgct ggtctcgtac tacgacgagt tggtcagcag gtactgggga       120
     cggccgtgcg agccgggcga agtcgacgcg gcgatgcgcg acgagcccaa cgatgatctg       180
     gtcgcattcc tggtggcgag cgtcggcgag gagcccgcgg gctgcgtcgg cgtgcggatg       240
     ctggcgccgg aggtggccga gctgagccgg atgtacatcc gtccgcagtt ccggcgctcc       300
     ggtggcgggc gattgttgct cggcgaagcc gatcgcgcgg ctgccgaact cggtgcgcgc       360
     gccatccgac tggacacgcg gggcgacttg gtggaggccc gcgcgatgta tgcgcggtac       420
     ggctatcgcg agatcccggc ctacaacgac agcaagtacg cgaaccactg gttcgagaag       480
     actctgtag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page