(data stored in ACNUC7421 zone)

EMBL: CP001700.PE376

CP001700.PE376       Location/Qualifiers
FT   CDS_pept        complement(422022..422486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0378"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sco:SCO7709 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69331"
FT                   /db_xref="GOA:C7PVH5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69331.1"
FT                   /translation="MNATPADPPPPAVEDVATHLRSAVGTLVRSTRAVDRIAPIPAAVL
FT                   DLLAARGPMTTADLASSRGVRHQTMAATVKDLADAGFLSAGPDPDDARKKILALTEAGR
FT                   HALDADRRQRTVLLAAALDQALDADELRVLARALDLLDRVSVAVNQMTAT"
     gtgaacgcca cccctgcgga cccgccgcct cctgccgtcg aggacgtggc cacgcacctg        60
     cgcagcgcgg tcggcactct ggtccgcagc acccgtgcgg tggaccggat cgctcccatc       120
     ccggcggcgg tgctcgatct gctcgccgcg cgcggaccga tgaccacagc cgatctggcg       180
     tcaagccgcg gcgtgcggca ccagacgatg gccgcgaccg tgaaggacct ggccgacgcc       240
     ggattcctca gcgccggacc cgatccggac gacgcgcgca agaagatcct cgcgctgacc       300
     gaggcgggga ggcatgcgct cgacgccgac cgccgacagc gcaccgtgct gctcgccgca       360
     gcgctggacc aggcgctgga cgcggacgaa ctgcgcgtcc tggcgcgggc gctggatctg       420
     ctcgaccggg tttccgtcgc cgttaaccag atgacagcga cgtga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page