(data stored in ACNUC7421 zone)

EMBL: CP001700.PE377

CP001700.PE377       Location/Qualifiers
FT   CDS_pept        422561..423196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69332"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH6"
FT                   /inference="similar to AA sequence:KEGG:SCO7708"
FT                   /protein_id="ACU69332.1"
FT                   /translation="MQLIKHAHACVSLVGDQGRIVIDPGTLTPDAAAAVAAAEAVLITH
FT                   EHFDHFDEDMLAKALDARPELRVYGPASVVGRWEARRGQVTAVAAGDRHAVAGFDIAVF
FT                   GELHALIHRDVPRVTNVGYLVDEKLYHPGDAYHVPEAPVETLLLPTSGPWTKLGEAVDY
FT                   VREVAPKQAVQIHELLLAEVGQQAAKTMIGNLTEAAMAIVPVGEAITV"
     atgcagctga tcaagcacgc ccacgcctgc gtctcgctgg tcggcgacca ggggcggatc        60
     gtcatcgacc ccgggacgct gacccccgac gcggccgcgg cggtggccgc cgccgaagcg       120
     gtgctgatca cccacgagca cttcgaccac ttcgacgagg acatgctcgc caaggccctg       180
     gacgcgcgtc ccgagctgcg ggtctacggt cccgcgagcg tggtcgggcg ctgggaggcg       240
     cggcgcgggc aggtcaccgc ggtggccgcc ggcgaccggc acgccgtggc ggggttcgac       300
     atcgccgtct tcggcgagct gcacgcgctg atccaccgcg acgtgccgcg cgtgaccaac       360
     gtcggctacc tcgtcgatga gaagctctac caccccggcg acgcctacca cgtacccgag       420
     gcgccggtcg agacgctgct gctgcccacg agcggaccgt ggacgaagct cggcgaggcg       480
     gtcgactacg tgcgcgaggt cgcgccgaag caggccgtcc agatccacga actgctgctc       540
     gccgaggtgg gccagcaggc ggcgaagacc atgatcggca acctgaccga ggcggccatg       600
     gcgatcgtcc cggtcggcga ggcgatcacc gtctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page