(data stored in ACNUC7421 zone)

EMBL: CP001700.PE378

CP001700.PE378       Location/Qualifiers
FT   CDS_pept        complement(423278..423928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0380"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sgr:SGR_3047
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69333"
FT                   /db_xref="GOA:C7PVH7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU69333.1"
FT                   /translation="MVQTETGTPRQRYRAQVQEEIKQHAWEQIATAGASALSLNAIAKQ
FT                   MGMSGPALYRYFANRDELITALIRDAYQSMADAMRAAVADGAGLRGLARTLREWALEDP
FT                   QRYLLIYGTPVPGYQAPEDTTRLANDVMALLLDASSAEGLGALPPSPVQTHLEQHSPWA
FT                   GAHAGEGTTLHRAVILWTRLHGVLSLELAGHFAGMEFDPALLYAAEVEAVAGY"
     atggtgcaga cggagaccgg aacccccagg cagcgctatc gcgcgcaggt gcaggaggag        60
     atcaagcagc acgcgtggga gcagatcgcg accgcgggcg cctccgccct gtcgctgaac       120
     gcgatcgcca agcagatggg gatgagcggc ccggcgctgt accggtactt cgccaatcgc       180
     gacgagctga tcacggcgct catccgggac gcctaccaga gcatggccga cgcgatgcgc       240
     gcggcggtcg cggacggcgc cggtctcagg ggtctggctc ggacgctgcg cgagtgggcg       300
     ctggaggacc cccagcgcta cctgctcatc tacggcacgc cggtacccgg ctaccaggcg       360
     ccggaggaca ccacgcggct ggccaacgac gtgatggcgt tgctgctcga cgccagcagc       420
     gccgaagggc tcggcgccct gccgccgtcg ccggtgcaga cacatctgga gcagcacagc       480
     ccgtgggctg gagcgcacgc cggcgaaggc acgacactgc accgcgccgt catcctgtgg       540
     acgcggctgc acggggtgct gtcgctggag ctggccgggc atttcgccgg catggaattc       600
     gacccggcgc tgctgtacgc ggccgaggtc gaggccgtcg caggttactg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page