(data stored in ACNUC7421 zone)

EMBL: CP001700.PE379

CP001700.PE379       Location/Qualifiers
FT   CDS_pept        424024..425055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0381"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sma:SAV_1467 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69334"
FT                   /db_xref="GOA:C7PVH8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH8"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU69334.1"
FT                   /translation="MTDQTLVQVVLPGKVEPEDLQVQHAAVPQPAVGQVVIAMEATGVS
FT                   FAEQQMRRGRYFDQPPFPFVPGYDVVGRVYAVGAGVDPGLLGRRVAVLTKVGGWASHVL
FT                   ADARDAVEVPEGLTAEQAETVVVNGITAWQMLHRRARVKAGQTVLVHGVNGGVGSVLAQ
FT                   LAMAAGATVIGTASARHHDALRAAGILPVDYRAGNVPEQVRALAPHGVDAVFDHVGGRS
FT                   VIDSWHLLAPGGTLVSYGSASTRDDSGWKQWPVLKILARTTLWTLLPNGRSASFFNIWA
FT                   GKKLNQDRFRARLRADLTEVFAALGRGDIVTTIAARLPLAQAGEAMRLAESGTVAGKII
FT                   LTP"
     atgaccgatc agactctcgt ccaggtggtt ctgccgggga aggtggagcc ggaggacctg        60
     caggtccagc acgcggccgt gccgcagccg gccgtcggcc aggtcgtcat cgccatggag       120
     gcgaccggcg tctccttcgc cgagcagcag atgcgccgag ggcgctactt cgaccagccg       180
     ccgttcccct tcgtccccgg ctacgacgtg gtcggccggg tgtacgcggt cggcgccggg       240
     gtggatccgg gcctgctggg ccggcgcgtg gccgtgctga ccaaggtcgg cggctgggcg       300
     agccacgtcc tggctgacgc ccgggacgcg gtcgaggtcc ccgaagggct gaccgccgag       360
     caggccgaaa ccgtggtggt caacgggatc accgcctggc agatgctgca ccgccgcgct       420
     cgggtgaagg ccggccagac ggttctggtg cacggcgtca acggcggcgt cggctcggtc       480
     ctggcccagc tcgcgatggc ggccggcgcg acggtgatcg gtactgcctc ggcccggcat       540
     cacgacgccc tgcgcgccgc cgggatcctg ccggtcgact accgcgccgg gaacgtgccc       600
     gagcaggtcc gcgccctggc tccgcacggc gtggacgcgg tcttcgacca cgtcggcgga       660
     cgcagcgtca tcgactcctg gcacctgctc gcccccggcg gcacgctcgt gtcctacggc       720
     tccgcctcga cccgcgacga cagcggctgg aagcagtggc cggtactgaa gatcctggcc       780
     cgcaccacgc tgtggaccct gctgccgaac ggccgcagcg cctcgttctt caacatctgg       840
     gccggaaaga agctgaacca ggaccgcttc cgtgcccggc tgcgcgccga cctcaccgag       900
     gtcttcgcag ccctgggacg cggcgacatc gtcaccacga tcgcggcccg gctaccgctg       960
     gcgcaggccg gcgaggcgat gcggctggcc gagtccggga cggtcgccgg aaagatcatc      1020
     ctgacgccct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page