(data stored in ACNUC7421 zone)

EMBL: CP001700.PE38

CP001700.PE38        Location/Qualifiers
FT   CDS_pept        40430..42532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0038"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: sgr:SGR_3725
FT                   putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68993"
FT                   /db_xref="GOA:C7QFQ4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU68993.1"
FT                   /translation="MSGTYPGAEQPRRLGGRYELGAVLGRGGMAEVFMARDTRLGRTVA
FT                   VKTLRADLSRDPTFQARFRREAQSAASLNHPAIVAIYDTGEDFENGVSVPYIVMEYADG
FT                   STLRDLLHSGRRLLPERALEITAGVLQALDYSHRNGIIHRDIKPANIMLTRSGTVKVMD
FT                   FGIARAMADNGMTMTQTAAVIGTAQYLSPEQAKGETVDARSDLYSTGCLMFELLTGRPP
FT                   FVGDSPVAVAYQHVREEPQPPSSYDPEVSPAIDAVVLKSLAKTADARYQSATEMRADIE
FT                   RVLDGRPTEAQTAVLGAANMPTQRLDPRQVGAAAAVGQTRAMPAVDTPTGYQSPAPRYE
FT                   EGLDGPGGRPPGPPRRAEPRRAPEPEKSGRTGYIILAIAGIAAVIAAILLAKSLLKSGG
FT                   NASSKAAPDFGIGVKTFPQAQQMLAQPDYTGFSLTGSGKDCPPGTDVHSGNAGTIIAQS
FT                   PAAGAYGKPGPITYCLSLGPQNGKVPPKATLNGMNQDQLKAYLGGAHFDLANPLITSQP
FT                   DPKVLAGNIIDVIDAGNNNAVLDGQQVPDVSKVQIGWIVSAGPSKIPLSTQGYIGQPYN
FT                   SVVSQIQGLGFTNVKPVVDNPGGNLPAGSVTRISPGDNSYTADTPIVVYYAPQPVAPTT
FT                   PTSSQSQGCDPNQDPTCQQNPTSTASGPGNGQTSSNPMLCVVDPNAPGCPNAPTTSKKG
FT                   GGGGGN"
     atgtccggaa cctaccccgg tgcggaacag ccgcggcggc tcggcggcag gtacgagctg        60
     ggcgcggtgc tgggccgagg cgggatggcc gaggtcttca tggcccgcga cacccggctg       120
     ggccgcacgg tcgcggtcaa gaccctgcgg gccgacctgt cccgggaccc cacgttccag       180
     gcacggttcc gccgcgaggc gcagtccgcg gcctcgctca accacccggc gatcgtggcg       240
     atctacgaca ccggcgagga cttcgagaac ggcgtctcgg tcccctacat cgtgatggag       300
     tacgccgacg gctccacgct gcgcgacctg ctgcactccg gccgccggct gctgcccgag       360
     cgggccctgg agatcaccgc cggcgtgctg caggctctgg actactccca ccgcaacggc       420
     atcatccacc gcgacatcaa gcccgcgaac atcatgctga cccggtccgg caccgtgaag       480
     gtgatggact tcggcatcgc ccgcgccatg gccgacaacg gcatgacgat gacgcagacc       540
     gccgcggtca tcggcaccgc gcagtacctg tcgccggagc aggccaaggg cgagaccgtc       600
     gacgcccgca gcgacctgta ctccaccggc tgcctgatgt tcgagctgct caccggccgc       660
     ccgcccttcg tcggcgactc cccagtcgcc gtggcctacc agcacgtgcg cgaggagccg       720
     cagccgccgt cctcctacga ccccgaggtc agcccggcga tcgacgcggt ggtgctcaag       780
     tcgctggcca agaccgccga cgcgcgctac cagtcggcga ccgagatgcg cgccgacatc       840
     gagcgggtgc tcgacgggcg cccgaccgag gcgcaaaccg cggtgctggg cgcggcgaac       900
     atgccgaccc agcggctgga cccgcgccag gtgggcgccg cggccgcggt cggccagacc       960
     cgggcgatgc ccgcggtcga cacgccgacc ggctaccaga gccccgcgcc gcgctacgag      1020
     gagggcctgg acggacccgg cggccgcccg ccgggtccgc cgcgccgcgc cgagccgcgc      1080
     agagcccccg agccggagaa gagcggccgg accggctaca tcatcttggc catcgccggc      1140
     atcgccgcgg tgatcgccgc gatcctgctg gccaagtcgc tgctgaagtc cggcggcaac      1200
     gccagctcca aggcggcgcc ggacttcggc atcggggtga agaccttccc gcaggcgcag      1260
     cagatgctgg cgcagccgga ttacacgggg ttcagcctta ccggcagcgg caaggactgt      1320
     ccccccggaa ccgacgtgca ctccgggaac gccgggacga tcatcgccca gagcccggcg      1380
     gccggcgcct acgggaagcc gggaccgatc acctactgcc tgtcgctggg cccgcagaac      1440
     ggcaaggtac cgccgaaggc caccctcaac ggaatgaacc aggaccagct caaggcctat      1500
     ctgggcggcg cccacttcga cctcgccaac ccgctgatca cctcgcagcc cgatcccaag      1560
     gtcctggcgg gcaacatcat cgacgtgatc gacgcgggca acaacaacgc ggtgctcgac      1620
     ggccagcagg ttcccgacgt gagcaaggtt cagatcggct ggatcgtctc ggccggcccg      1680
     tcgaagatcc cgctcagcac ccagggctac atcggccagc cgtacaacag cgtcgtctcg      1740
     cagatccagg ggctgggctt caccaacgtc aagccggtgg tcgacaatcc gggcggcaac      1800
     ctgccggccg gcagcgtgac ccgcatcagc cccggagaca actcctacac cgccgacacg      1860
     ccgatcgtgg tctactacgc gccgcagccg gtggcgccga ccacgccgac cagctcgcag      1920
     tcgcagggct gcgacccgaa ccaggatccg acctgtcagc agaaccccac gtcgacggcg      1980
     tccggaccgg gcaacggcca gacctcgtcg aacccgatgc tgtgcgtcgt ggacccgaac      2040
     gcgccggggt gcccgaacgc tccgacgacg tccaagaagg gcgggggcgg cggcggcaac      2100
     taa                                                                    2103
//

If you have problems or comments...

PBIL Back to PBIL home page