(data stored in ACNUC7421 zone)

EMBL: CP001700.PE380

CP001700.PE380       Location/Qualifiers
FT   CDS_pept        425100..425504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0382"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   ana:alr3729 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69335"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="PDB:4H3U"
FT                   /db_xref="PDB:4HVN"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVH9"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ACU69335.1"
FT                   /translation="MTTPEIVTAWAAAWTGTNPNALGTLFAADGTYVDHAIGATMTGRE
FT                   QISGWKARTDAMIENVHVTITKAYRAGDHVTIEAVYGGHIKGAPTPFAVPMATLLRTRG
FT                   EEITSDQDYYSLSSVLAQSGLPADWTPSDS"
     atgaccaccc ccgagatcgt caccgcttgg gccgccgcct ggaccggcac caacccgaac        60
     gccctcggca cgctgttcgc cgccgacggc acctacgtcg accacgcgat cggcgccacc       120
     atgaccggcc gcgagcagat ctccggctgg aaggcgcgca ccgacgcgat gatcgagaac       180
     gtgcacgtca ccatcaccaa ggcctaccgt gccggcgacc acgtcacgat cgaggccgtc       240
     tacggcggtc acatcaaggg cgcgccgacg ccgttcgccg tcccgatggc gaccctgctc       300
     cggacccgtg gcgaggagat cacctccgac caggactact acagcctgag ctcggtcctc       360
     gcacagtccg gcttgccggc cgactggacc ccgtcggact cctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page