(data stored in ACNUC7421 zone)

EMBL: CP001700.PE381

CP001700.PE381       Location/Qualifiers
FT   CDS_pept        complement(425684..426577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0383"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sma:SAV_7306 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69336"
FT                   /db_xref="GOA:C7PVI0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU69336.1"
FT                   /translation="MQFHQLRYFIAVAETRHFTRAAEALHVTQPSLSQQIRALEHELGA
FT                   DLFLRARGNITLTDAGEALLPMARRILADADAARREVQELAELRRGHVRLGATPSLCTG
FT                   LLPDVLRTYHRRYPGIQLLVQESGSHDLVRDLARGALDLALVVLPLPSPSPALTTEELL
FT                   REDLVVVSAPNLPPPGDGRQVRIADLEHEQLIMFRHGYDLRDLTVAACRAQGFEPVFAI
FT                   EGGEMDAVLGFARAGLGVAIVPSMVAQNVDPSLRVTPIAPPALHRTIALAHRTDVALPR
FT                   AAQEFRRTLLERTTAE"
     atgcagttcc accagctccg atacttcatc gcggtggccg agacgcgcca cttcacgcgc        60
     gccgccgaag ccctgcatgt gacgcagccc tcactgtccc agcagatcag agccttggaa       120
     cacgaactcg gggcggacct cttcctgcgc gcccgcggca acatcacgct gaccgacgcc       180
     ggcgaggcct tgcttccgat ggcccggcgc atcctcgcgg acgccgatgc ggcacggcgc       240
     gaggttcagg agttggccga gctccggcgg ggtcacgtgc ggctcggggc gacgccatct       300
     ctatgtacgg gactgcttcc agacgtcctt cggacctacc accggcgcta tcccggcatc       360
     cagctgctgg tccaggagag cggttcgcac gacctggtcc gggacttggc acgcggcgcg       420
     ttggacctgg ccctggtcgt gctgccgctg ccgtccccgt cgccggcgct caccacggag       480
     gagctgctgc gggaagatct ggtcgtcgtc tcggcgccga acctcccgcc gcccggcgac       540
     ggccggcagg tgcgcatcgc agacctcgaa cacgagcagc tgatcatgtt ccggcacggc       600
     tacgacctgc gcgacctgac cgtggcggcg tgccgcgcgc agggtttcga gccggtcttc       660
     gcgatcgagg gcggcgagat ggacgcggtg ctcggcttcg cgcgggccgg gctcggcgtg       720
     gcgatcgtgc cgagcatggt ggcgcagaac gtcgatccga gcctgcgcgt cacgccgatc       780
     gcgccgccgg cgctgcaccg caccatcgcg ctggcgcatc gcaccgatgt ggcgctgccg       840
     cgtgcggcgc aggagttccg gcggacgctg ctcgagcgca ccacagcaga gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page