(data stored in ACNUC7421 zone)

EMBL: CP001700.PE382

CP001700.PE382       Location/Qualifiers
FT   CDS_pept        426686..427390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0384"
FT                   /product="succinate dehydrogenase (or fumarate reductase)
FT                   cytochrome b subunit, b558 family"
FT                   /note="TIGRFAM: succinate dehydrogenase (or fumarate
FT                   reductase) cytochrome b subunit, b558 family; KEGG:
FT                   sco:SCO0924 cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69337"
FT                   /db_xref="GOA:C7PVI1"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI1"
FT                   /inference="protein motif:TFAM:TIGR02046"
FT                   /protein_id="ACU69337.1"
FT                   /translation="MVTATWTDRRPPSLRTAWDSSVGKKTVMAVSGLVMVLYLLAHAFG
FT                   NLKVFFGPGQFDSYAHWLRTMGEPVMHYSWTLWVIRVVMVLAVVAHTVSAYQLSRRDIR
FT                   ARPVRYEHRKAGSSYATRTMRWGGIILGLFIIWHLLDLTTGTVHSGFQPGHPYANVVST
FT                   FNHWYGDVIYIVAVCALGLHIQHGFWSAAQTLGVGSAKRDRLIKTTGNVVAVLLTLAFV
FT                   AVPVGVMSGVVK"
     atggttaccg ctacgtggac ggaccggcgt ccgccttccc tgcgcacggc ttgggacagc        60
     tccgtcggca agaaaaccgt catggcggtc agcggcctgg tcatggtgct ctacctgctg       120
     gcccacgcgt tcgggaacct gaaagtcttc ttcggcccgg ggcagttcga cagctacgcg       180
     cactggctgc ggaccatggg cgagcccgtc atgcactaca gctggacgct gtgggtcatc       240
     cgggtcgtga tggtcctcgc cgtggtcgcg cacacggtct ccgcctacca gctcagccgc       300
     cgcgacatcc gggcgcgtcc ggtgcggtac gagcaccgca aggccgggag cagctacgcg       360
     acgcggacga tgcgctgggg cgggatcatc ctcgggctgt tcatcatctg gcatctgctc       420
     gacctgacga ccggcaccgt gcactccgga ttccagccgg gccatcccta cgcgaacgtc       480
     gtctcgacct tcaaccactg gtacggcgac gtcatctaca tcgtggccgt gtgcgcgctg       540
     ggcctgcaca tccagcacgg cttctggtcc gccgcgcaga cgctcggcgt gggcagtgcg       600
     aagcgcgacc gcctgatcaa gaccaccggc aacgtggtcg ccgtgctgct cacgctcgcc       660
     ttcgtggcgg tgccggtggg cgtgatgagc ggagtggtga agtga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page