(data stored in ACNUC7421 zone)

EMBL: CP001700.PE383

CP001700.PE383       Location/Qualifiers
FT   CDS_pept        427387..429336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0385"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /note="KEGG: sco:SCO0923 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69338"
FT                   /db_xref="GOA:C7PVI2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI2"
FT                   /inference="protein motif:TFAM:TIGR01811"
FT                   /protein_id="ACU69338.1"
FT                   /translation="MTDYTDYTVGDPIADAKAPAGPISERWDTRRFEAKLVNPANRRKR
FT                   TVIVIGTGLAGGSAGATLAEAGYHVVQFCFQDSPRRAHSIAAQGGINAAKNYRNDGDSV
FT                   HRLFYDTVKGGDFRSRESNVHRLAQISVEIIDQCVAQGVPFAREYGGLLDTRSFGGVQV
FT                   SRTFYARGQTGQQLLLGAYQAMMRQVAAGNIELHARTEMLDLIVVDGRARGIVARDLLT
FT                   GEISTYFGDAVVLASGGYGNVYYLSTNAMNSNATAIWRAHRKGAYFGNPCYTQIHPTCI
FT                   PRTGDHQSKLTLMSESLRNDGRIWVPKAKGDSRSPDAIPEDERDYYLERQYPSFGNLVP
FT                   RDIASRAAKNVCDEGRGVGPGGQGVYLDFADAIKRLGRKAVEEKYGNLFEMYQRITDED
FT                   PYRVPMRIYPAVHYTMGGLWVDYDLQTTVPGLFAVGEANFSDHGANRLGASALMQGLAD
FT                   GYFVLPATISDYLARHAGDVPVTADHPEAVAAVRETQERLDAILAVDGDRTPDSFHREL
FT                   GELMWELCGMARDEAGLRKALDQIPAIREEFWRRIKVPGTGEEFNQSLEKANRLVDYFE
FT                   LAELMCLDALHRGESCGGHFRTESQTPDGEAARKDEEFSYVAAWEYTGLGQAPVLHREE
FT                   LDFEYVHPAQRSYA"
     gtgaccgatt acacggatta caccgtcggc gacccgatcg ccgacgccaa ggctccggcc        60
     ggaccgatca gcgaacgctg ggacacccgc cgcttcgagg ccaagctggt caacccggcg       120
     aaccggcgca agcgcacggt gatcgtcatc ggcaccggcc tggccggcgg atccgccgga       180
     gcgacgctgg ccgaggcggg ctaccacgtc gtgcagttct gcttccagga ctcgccgcgg       240
     cgcgcgcact cgatcgccgc acagggcggg atcaacgccg cgaagaacta ccgcaacgac       300
     ggcgactcgg tgcaccggtt gttctacgac accgtcaagg gcggcgactt ccggtcgcgc       360
     gagtcgaacg tgcaccggct ggcgcagatc tccgtggaga tcatcgacca gtgcgtcgcg       420
     caaggcgtgc cgttcgcgcg cgaatacggc gggctgctcg acacgcgctc gttcggcggc       480
     gtgcaggtct cccgtacctt ctacgcgcgc gggcagacgg ggcaacagct gctgctcggc       540
     gcgtaccagg ctatgatgcg gcaggtcgcc gccggcaaca tcgagctcca cgcgcgcacc       600
     gagatgctcg acctgatcgt cgtcgacggc cgggctcgcg gcatcgtcgc gcgtgacctt       660
     ctgaccggcg agatctccac gtacttcggc gacgcggtcg tcttggcgtc cggcggttac       720
     ggcaacgtct actacctgtc gaccaacgcc atgaactcga acgcgaccgc catctggcgc       780
     gcgcatcgta agggtgctta cttcggaaac ccctgctaca cgcagatcca cccgacctgc       840
     atcccacgca ccggcgacca tcagtcgaag ctgacgctga tgtcggagtc gctgcgcaac       900
     gacggccgga tctgggtgcc caaggcgaag ggcgattcgc ggtctcccga cgcgatcccc       960
     gaggacgagc gcgactacta cctggagcgt cagtaccctt ccttcggcaa cctcgttccc      1020
     cgcgacatcg cctcgcgcgc cgcgaagaac gtctgcgacg agggtcgcgg cgtcggaccc      1080
     ggcgggcagg gcgtgtatct ggacttcgcc gacgccatca agcggctggg gcgcaaggcg      1140
     gtcgaggaga agtacgggaa cctcttcgag atgtaccagc ggatcaccga tgaggatccg      1200
     taccgcgttc cgatgcgtat ctatccggcc gtgcactaca cgatgggcgg cctgtgggtg      1260
     gactacgacc tgcagaccac ggtccccggg ctgttcgcgg tcggcgaggc gaacttctcc      1320
     gaccacggcg ccaaccggct cggcgcgtcg gcgctgatgc agggactggc cgacggctac      1380
     ttcgtgctcc cggcgacgat cagcgactac ctcgcgcggc acgccggcga cgtgccggtg      1440
     accgccgacc acccggaggc ggtcgcggcg gttcgcgaga cgcaggaacg gctggacgcg      1500
     atcctcgcgg tcgacggcga ccgcaccccg gactccttcc accgcgaact cggcgagctg      1560
     atgtgggagt tgtgcggcat ggcgcgcgac gaggccgggc tgcgcaaggc gctggaccag      1620
     atcccggcga tccgtgagga gttctggcgc cggatcaagg ttccgggcac cggcgaggag      1680
     ttcaaccagt cgctggagaa ggcgaaccgg ctcgtcgact acttcgagct cgccgagctg      1740
     atgtgcctgg acgccctgca ccgcggcgag tcctgcggcg gccacttccg caccgagtct      1800
     cagacccctg acggcgaggc ggcgcgcaag gacgaggagt tctcctacgt cgccgcctgg      1860
     gagtacaccg gcctggggca ggcgccggtc ctgcaccggg aagagctcga cttcgaatac      1920
     gtccaccctg ctcaacggag ttacgcatga                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page