(data stored in ACNUC7421 zone)

EMBL: CP001700.PE384

CP001700.PE384       Location/Qualifiers
FT   CDS_pept        429333..430082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0386"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; ferredoxin; KEGG: sco:SCO0922 succinate
FT                   dehydrogenase/fumarate reductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69339"
FT                   /db_xref="GOA:C7PVI3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACU69339.1"
FT                   /translation="MKLTLRVWRQENASRPGRMQPYEIDGVSRDMSFLEMLDVLNEKLI
FT                   LDGEDPVAFDHDCREGICGACSLMIDGEAHGPEKKTTTCQLHMRSFRDGATIDVEPWRA
FT                   AAFPVVKDLVVDRSALDRVIQSGGYITAPTGAAPEAHATPIPKPAADLAFENAECIGCG
FT                   ACVAACPNGSASLFTAAKINHLNTLPQGAPERETRVLTMLQQTDAEGFGGCTLTGECAT
FT                   ACPKGIPLASIAAMNKEWLRAQRKASR"
     atgaagctca ctttgcgcgt ctggcggcag gagaacgcgt cccggccggg ccgcatgcag        60
     ccgtacgaga tcgacggcgt cagccgcgac atgtcgttcc tggagatgct cgacgtcctg       120
     aacgagaagc tgatcctcga cggcgaggac ccggtcgcct tcgaccacga ctgccgcgag       180
     ggcatctgcg gcgcctgctc cctgatgatc gacggcgagg cgcacggacc cgagaagaag       240
     accaccacct gccaactcca tatgcgcagc ttccgcgacg gcgccaccat cgacgtcgaa       300
     ccctggcgcg ccgccgcctt cccggtggtc aaagacctgg tcgtggaccg ctcagccctg       360
     gaccgcgtga tccagtccgg cggctacatc accgccccca ccggcgccgc ccccgaagcc       420
     cacgccaccc cgatccccaa gcccgccgcc gacctcgcct tcgagaacgc cgaatgcatc       480
     ggctgcggcg cctgcgtggc cgcctgcccc aacggctcag ccagcctgtt caccgccgcc       540
     aagatcaacc acctcaacac cctcccccaa ggcgcccccg aacgcgaaac ccgcgtcctc       600
     accatgctcc agcaaaccga cgccgaaggc ttcggcggct gcaccctcac cggcgaatgc       660
     gccaccgcct gccccaaggg catccccctg gcctccatcg ccgcgatgaa caaggaatgg       720
     ctgcgcgcac agcgaaaggc ctcgcgctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page