(data stored in ACNUC7421 zone)

EMBL: CP001700.PE385

CP001700.PE385       Location/Qualifiers
FT   CDS_pept        430499..431446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0387"
FT                   /product="sugar hydrolase"
FT                   /note="KEGG: sma:SAV_5252 sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69340"
FT                   /db_xref="GOA:C7PVI4"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI4"
FT                   /inference="similar to AA sequence:KEGG:SAV_5252"
FT                   /protein_id="ACU69340.1"
FT                   /translation="MPRTVRKSLIAGAAFLLPAAAVGVAAGASTAAAATHAASFPAHYS
FT                   APYLQISSSDAKDMAADMAASGDKFYTLAFLTPKSGCTPEWEDGGDSVGAFSSQITALQ
FT                   NAGGNVIISFGGAEGGELAQTCTSVSSLEAAYAKVVSTYHVTRLDFDIEGSVLDNKTAN
FT                   SRRDQALAALQKANPAVQVDFTLPVDPTGLESNATALLSDAKSKGVAVNLVNIMTMDFG
FT                   DGQNALKDAESGANATVPQLEKVFGVSSTKAWNMLGLTPIAGKNDDNENFTQANASTLE
FT                   SFAASKGVQELSFWEVDGYDKGVGYAYSKIFNKI"
     atgcccagaa ctgttcgcaa gagtctgata gccggtgcgg cttttctgct gccagctgct        60
     gctgtcgggg tcgcggcggg tgcttcgacc gccgctgccg ccactcatgc cgcgtcgttt       120
     cccgcccact actccgcgcc gtatctgcag atctcgtcga gcgatgccaa ggacatggct       180
     gcggacatgg cggccagtgg cgacaagttc tacacgctgg cgttcctgac gccgaagtcg       240
     gggtgtacgc cggagtggga agacggcggc gactcggtgg gggcgttcag ctcgcagatc       300
     accgcgctgc agaacgccgg cgggaacgtg atcatctcct tcggcggggc ggagggcggg       360
     gagttggcgc agacctgtac cagcgtctcc agtctggagg ccgcgtacgc caaggtcgtc       420
     agcacgtatc acgtcacgcg cctggacttc gacatcgagg gcagcgtgct ggacaacaag       480
     accgccaact cccggcggga ccaggcgttg gcggcgctgc agaaggcgaa tccggctgtg       540
     caggtcgact tcacgctccc ggtcgacccc accggtctgg agtccaacgc caccgcgctg       600
     ctgtccgacg ccaagagcaa gggcgtcgcc gtcaacctcg tcaacatcat gacgatggac       660
     ttcggcgacg gccagaacgc gctgaaggac gccgagtccg gcgccaacgc gaccgtcccg       720
     cagctcgaga aggtcttcgg cgtctccagc accaaggcct ggaacatgct cggcctgacc       780
     ccgatcgccg gcaagaacga cgacaacgag aacttcaccc aggccaacgc ctccacgctg       840
     gagagcttcg ccgcctccaa gggcgtgcag gaactgtcct tctgggaagt cgacggctac       900
     gacaagggcg tcgggtacgc ctactccaag atcttcaaca agatctag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page