(data stored in ACNUC7421 zone)

EMBL: CP001700.PE386

CP001700.PE386       Location/Qualifiers
FT   CDS_pept        431849..435232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0389"
FT                   /product="WGR domain-containing protein"
FT                   /note="KEGG: stp:Strop_2883 WGR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69341"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI5"
FT                   /inference="similar to AA sequence:KEGG:Strop_2883"
FT                   /protein_id="ACU69341.1"
FT                   /translation="MSGATNAPTAVSEDTCQIPGAMRRLVIPRRGDVPSEPVAVDPKAA
FT                   AYYAAWFDEQSPIVAGIVDHGHSEADLVEEYRASKGDLVIATPLAAAVAAAMTISQSTP
FT                   AYENPAGIVDAWIATRGLAFAAAAAVELFGVKTSGRTSKGEQASAWLCRKDGAYEDIPH
FT                   GIAVRVRQHLASAGEQDYAEVADVLARYRLSLASPTTSGQVLSRMLTSFLTPENVDWVE
FT                   SDFAFVSRAHYSAWLALASITTEEQVAALPAQKISAWGIARELSALWTALDNVGVHLLP
FT                   VLTGWLAPESDPESVQRLLSIVAGIASADAFRYLVDNIDKKYFTVATQNAATTFPRRAL
FT                   QILGDAALRDTPRGLAAANVLRLHIVAHDELVQDELANLTPAVRDHVEKIRAANVPVPD
FT                   AETDSLPTLFVSPPWLTAVKPARPVVITGLEAPTETVLAWRDGEKEQWASAELITNPQW
FT                   KLESWKDIADRISTGGSAGWYANGHFAVEAPEDLVRSVLTSWEPDSWQSDTWIPTLVMR
FT                   FGADALPPILSLARSVPASGAVFLAPFEAPEVALLAADWLSRLKTARPFALAWLTRHPG
FT                   FAARTLIPAALGKAGKARSAAELTIRTLAARGFTAEITEAAAGYGDAVAQAVAAIVADD
FT                   GTLTLPKTMPAVPDWAETRLLPQILLKGRQTALPEQSVKHLLLMLAVSKGTEPYAGIQM
FT                   AKGICDPASLATFSWALFENWRGVDYPAKESWAFDALRWFGDDETVRRLSPMIRLWPGE
FT                   NGHQRAVAGLDVLADIGGTVALMHLYGISQKVKFKGLKEQATQRVTEIADDLGLTAEQL
FT                   GDRLVPDLGLASSGTLSLDYGPRSFTVGFDEQLKPYVADQSGKRLKALPKPGAKDDQEL
FT                   APAAHQQFSALKKDVRTLAASQIARFELAMVTQRRWTSQEFGEYFVGHPLLRHLVRRLV
FT                   WVTFVDEKVGSAFRVAEDLSLADIADDEFTLADDAVIGVAHPLHIGGDVAAWSDVFADY
FT                   EILQPFAQLGRTVFAFTDAEKASTRLTRFGGIETPVGKVLGLERRGWRRGAPQDAGIQG
FT                   WISRALLGGGSVTATLDPGITVDYVAEWGETQRLQEVFISRHADGESYWNASAKFRELG
FT                   SLDEITASELLRDLTEATTQ"
     atgagcggcg ccaccaacgc acccaccgca gtgtcggaag acacgtgcca gatccccggg        60
     gcgatgcgcc gcctcgtgat tccccgccgg ggcgatgttc cgagcgaacc ggtcgccgtc       120
     gatccgaaag ccgccgcgta ttacgccgca tggtttgacg agcagagccc gatcgtcgcc       180
     gggatcgtcg accacggaca cagcgaagcc gatctcgtcg aggagtaccg agcttccaag       240
     ggcgacctcg tcatagccac gccgcttgcc gcagcggtcg cggcggcgat gacgatctcg       300
     cagagcacgc cggcgtacga gaaccccgcc ggcatcgtcg atgcctggat cgccacgcgc       360
     ggtctcgcat tcgccgcggc cgccgctgtc gagctgttcg gcgtgaagac ctcgggccgc       420
     acctccaagg gagagcaagc ttcagcgtgg ctctgccgca aggacggcgc ctatgaagac       480
     atacctcatg gaatcgccgt ccgcgtgcgc cagcacctgg catcggcggg ggagcaggac       540
     tacgcggagg tcgccgatgt ccttgcgcgc taccggctat cgctggcgtc cccgacgacc       600
     tccggtcaag tgctgtcgcg catgctcacg tccttcctga cgccggagaa cgtcgactgg       660
     gtcgagagcg acttcgcgtt cgtctcgcgg gcgcattact ccgcgtggct cgcgctcgcc       720
     tcgatcacga ccgaggagca agtagccgcc ttgccggcgc agaagatctc ggcgtggggc       780
     atcgcccgag agctcagtgc gctgtggacc gcgctcgaca acgtcggcgt ccatctcctc       840
     ccggtcctga ccggatggct cgctcccgag tcggacccgg aaagcgttca gcgcctgctg       900
     tccatcgtcg cgggcatcgc gtccgcagac gccttccgct acctcgtcga caacatcgac       960
     aagaagtact tcacggttgc gacgcagaac gctgccacca cctttccccg gcgcgctctc      1020
     cagatcctcg gcgacgccgc gctccgcgac actccgcgcg ggctggctgc cgccaacgtg      1080
     ctgcgcttgc acatcgtcgc gcacgacgaa ctcgtgcagg acgagctggc gaacctcact      1140
     ccggcggtac gggatcacgt cgagaagatc cgcgccgcca acgtccccgt gcccgacgcc      1200
     gagacagaca gcctgccgac gctgttcgtc agcccgccgt ggctgaccgc cgtgaagccg      1260
     gccaggccgg tcgtcatcac cggtctggag gcgccgaccg agacggtctt ggcgtggcgc      1320
     gacggcgaaa aagagcagtg ggcttccgcc gagctcatca cgaatcccca gtggaaactc      1380
     gaaagctgga aggacatcgc cgaccgcatc agcaccggtg gctcggccgg ctggtacgcg      1440
     aacggccact tcgccgtcga ggctcccgag gatctggtcc ggtcggttct caccagctgg      1500
     gagcccgact cctggcagtc cgacacctgg atcccaacgc tggtaatgcg tttcggcgcc      1560
     gacgcgctgc cgccgatcct gagcttggca cgcagcgtac cggcgtcggg tgccgttttc      1620
     ctcgccccgt tcgaggctcc cgaggtcgcc ctcctcgcgg ccgactggct cagccggctg      1680
     aagaccgcgc gaccgttcgc gctggcttgg ctgacgcggc atcccggctt cgcagccagg      1740
     accctgatac cggcggcgct cggcaaggcg ggcaaggcgc gcagtgccgc cgagctgacc      1800
     atccgcacac tggccgcacg cggattcact gccgagatca ccgaagccgc cgcagggtac      1860
     ggcgacgccg tggcgcaggc ggtcgccgcc atcgtcgccg acgacggcac gctcacgctg      1920
     cccaagacga tgcccgccgt cccggactgg gccgaaaccc ggctgctgcc gcagatcctg      1980
     ctcaagggac ggcagaccgc gttgcccgag cagtctgtga agcacctgct cctgatgctc      2040
     gcggtgtcca aaggtaccga gccctacgcc ggaatccaga tggcgaaggg catctgcgac      2100
     ccggcctcgc tcgccacgtt ctcgtgggcg ttgttcgaga actggcgcgg tgtcgactac      2160
     ccggcgaagg agagctgggc gttcgacgcg ctgcggtggt tcggcgacga cgagacggtg      2220
     cggcggctgt ccccgatgat ccgcctgtgg cccggcgaga acgggcatca gcgcgcggtc      2280
     gccggtctgg acgtactggc cgacatcggc ggaaccgtgg cgctgatgca cctctacggc      2340
     atctcgcaga aggtcaagtt caaggggttg aaggagcagg cgacgcagcg cgtcacggag      2400
     atcgccgacg acctcgggct caccgccgag cagttggggg accgtctcgt cccggacctc      2460
     gggttggcgt cctccgggac gctgtccctg gactacggtc cacggtcgtt cactgtcgga      2520
     ttcgacgaac agctgaagcc gtatgtcgcc gatcagagcg gcaagcgtct caaggctctg      2580
     ccgaagccgg gagcgaagga cgatcaggag ctcgcacccg ctgcccacca gcagttctcc      2640
     gcgctgaaga aggacgtgcg gacgctcgcc gcgagccaga tcgcgcgctt cgagctcgcc      2700
     atggtgacgc agcgccgctg gacgtcccag gagttcggcg agtacttcgt cgggcatccc      2760
     ttgctgcgac acctggtccg gcgcctggtc tgggtgacct tcgtcgatga gaaggtaggc      2820
     agcgccttcc gggtcgccga agacctgagt ctcgccgaca tcgcagatga cgaattcacc      2880
     ctcgccgacg acgcggtgat cggcgtcgcg catccgctgc acatcggcgg ggacgtcgcc      2940
     gcgtggtcgg acgtgttcgc cgactacgag atccttcagc cgttcgcgca attgggacgc      3000
     actgtgttcg cattcaccga cgcggagaag gcttcgacgc gcctgacccg gttcggcggc      3060
     atcgagactc ccgtcggcaa agtcctggga ctcgaacggc gcggctggcg ccggggtgct      3120
     ccgcaggacg ccggcatcca gggctggata tcacgcgcgc tcctcggcgg gggttcggtc      3180
     accgcgaccc tcgaccccgg catcaccgtc gactacgtcg ccgagtgggg cgagacgcag      3240
     cgtctccagg aggtcttcat cagccgccac gccgacggcg agagctactg gaacgcctcg      3300
     gcgaagttcc gcgagctcgg cagcctagac gagatcacgg cctccgaact cctccgcgac      3360
     ctgaccgagg cgacgaccca gtga                                             3384
//

If you have problems or comments...

PBIL Back to PBIL home page