(data stored in ACNUC7421 zone)

EMBL: CP001700.PE387

CP001700.PE387       Location/Qualifiers
FT   CDS_pept        complement(435538..436866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0390"
FT                   /product="Putative cell wall-binding domain-like protein"
FT                   /note="KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69342"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI6"
FT                   /inference="protein motif:COG:COG2247"
FT                   /protein_id="ACU69342.1"
FT                   /translation="MATTAHAGTAPHPAVAMAAVNVPAPPSGVSRISGGDRYLTGVQVS
FT                   QSQWADAGGDATGRAPAQAVVLARGDTFPDALSGVPLAAKVHGPLLLTTPAALSAGTAA
FT                   EIRRVLGPGAGQPVYILGGTGAVSPSVEAQLVRDGYAVTRYQGSNRYQTALDVARRGLG
FT                   DPARIVVATGDGYADALAAGPFAAGPDAVGGVPAAVVLSDGRSLDPATAAYVSGKLAAA
FT                   APGDCNAVTTVGGQAGTAVQAVTPAGSCTNPLAGADRYATAVAVAQQFPAGTSVGVATG
FT                   GGFADALTGGAAMAALGRPLVLTDPAVLGDNPRLWLVGAHQGGVGATAVFGGPSAVGGE
FT                   VFTQLQDIANGGAGLPTNALCGAPANPYGFNYCGVGSEVTVKAVPAAICSYFSCIGTDS
FT                   AHTSFWRGLGYLEVCDDGDISLSGGRSGACSSHGGENHPVWKR"
     atggccacca ctgcgcacgc gggcaccgcg ccgcacccgg cggtcgccat ggcggcggtg        60
     aacgtgcccg ctccgccctc cggcgtcagc cggatctccg gcggcgaccg ctacctgacc       120
     ggcgtccagg tatcccaatc gcagtgggct gatgccggcg gcgacgcgac cgggcgggct       180
     ccggcgcagg cggtcgtgct cgcgcgcggc gacacgttcc ccgacgcgct gtccggggtc       240
     ccgctggccg ccaaggtgca cggcccgttg ctgctcacca ccccggcggc gctgtcggcc       300
     ggcaccgccg ccgagatccg gcgcgtgctc ggacccggcg ccggacagcc ggtctacatc       360
     ctcggcggga ccggggcggt gtcgccgtca gtggaggcgc agctggtgcg cgacggctac       420
     gcggtgaccc ggtatcaggg ctcgaatcgc taccagacgg cgctggacgt ggcgcgccgg       480
     ggtctgggcg acccggcgcg gatcgtggtc gcgaccggcg acgggtacgc cgacgcgctc       540
     gccgcgggtc cgttcgcggc cggaccggac gcggtcggcg gcgtgccggc cgcggtcgtc       600
     ctgtccgacg gccgcagcct ggatccggcc accgcggcgt acgtctccgg gaagctcgcg       660
     gcggcggcgc ccggcgactg caacgccgtg accaccgtcg gcggccaggc aggcacggcc       720
     gttcaggccg tcacgcccgc cggttcctgc acgaacccgc tcgccggagc ggaccgctac       780
     gccacggccg tcgcggtcgc ccagcagttc ccggcgggca cctcggtcgg cgtcgccacc       840
     ggcggaggct tcgccgacgc gctgaccggc ggcgcggcga tggccgccct cggccgtccg       900
     ctggtgctca ccgacccggc cgtcctcggc gacaaccccc ggctgtggct ggtcggcgcg       960
     caccagggcg gggtcggcgc gaccgccgtc ttcggcggcc cgagcgcggt cggcggcgag      1020
     gtcttcacgc aactgcagga catcgcgaac ggcggcgccg gactgccgac caacgccctg      1080
     tgcggcgcac cggcgaaccc gtacggattc aactactgcg gcgtcggctc ggaggtcacc      1140
     gtgaaggcgg ttccggcggc catctgcagc tacttctcct gcatcggcac ggactcggcg      1200
     cacaccagct tctggcgcgg actcgggtac ctggaggtct gcgacgacgg cgacatctcg      1260
     ctgtccggcg gccgcagcgg ggcgtgttcc tcacacggcg gcgagaacca cccggtgtgg      1320
     aagcgatga                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page