(data stored in ACNUC7421 zone)

EMBL: CP001700.PE388

CP001700.PE388       Location/Qualifiers
FT   CDS_pept        complement(437082..437510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0391"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   ace:Acel_0050 FMN-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69343"
FT                   /db_xref="GOA:C7PVI7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI7"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ACU69343.1"
FT                   /translation="MRIPLIKTLLSLAGTVGTMGGLLAMKTSAHGLAPQPLQAAKVVHD
FT                   RTAGATMTVTGPAIPVTHGIVQVRITLTDGHITDVSATSLPHDNDDSWTRSVTAAMVLD
FT                   REVIAKQSAHIDGVSGATYTSKAYKASLQAAIDAGYRH"
     gtgcgaatcc cgcttatcaa gactctgctt tccctcgccg gaaccgtcgg cacgatgggc        60
     ggcctgctgg ccatgaagac ctccgcgcac gggctcgcgc cgcagccgct ccaggcggcg       120
     aaggtcgtgc acgacaggac cgccggcgcc acgatgaccg tcacgggacc ggcgatcccg       180
     gtcacccacg gcatcgtcca ggtccgcatc acgctcaccg acgggcacat caccgacgtc       240
     tcggcgacca gcctcccgca cgacaacgac gactcctgga cccgttcggt gacggcggcg       300
     atggtcctgg accgcgaggt catcgcgaag cagtcggcgc acatcgacgg cgtgagcggc       360
     gcgacgtaca cgtccaaggc gtacaaggcc tcgctccagg cggcgatcga cgcgggctac       420
     agacattga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page