(data stored in ACNUC7421 zone)

EMBL: CP001700.PE389

CP001700.PE389       Location/Qualifiers
FT   CDS_pept        complement(437531..438940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0392"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; FAD-binding 8 domain protein; Ferric reductase
FT                   domain protein transmembrane component domain; KEGG:
FT                   fal:FRAAL0548 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69344"
FT                   /db_xref="GOA:C7PVI8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C7PVI8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACU69344.1"
FT                   /translation="MVQGWSAGFEVPYDPDWVVPRRDWRHSLPLLPRRPLSAVLLAVLA
FT                   AGIAGLLALWWQETPADRMQSLPDYLVMLAQITGLVGAYLLLVEIALMARLPWLEHRLG
FT                   SWLASAHRSLGGYLVLLLCAHVGFVIAAYSVSVHDSPPAVLVSILRTYPGVLAATIGFL
FT                   VMLLAGFTSARSIRRRLGYEGWHAIHLLMYPAAAAAFWHQITLGAQFTRNPWAADVWVG
FT                   LHAVVGAAIVCNRIVIPLLNNRHHRFRVSRVEAVGPDAMNVYITGRRVADLGAEAGQYF
FT                   RWRFMQRSLWYQAHPFSLSAAPHADTLRLTFKCVGGYTRRLKRRLRPGSRVFLDGPYGA
FT                   FTGVLRRQPGVVMIGGGIGVTPLRAIVETMHNRRRNDIIFIQRASKVGDLILTNELEAL
FT                   NAVGRIIYIPAIGSRRNDPLSADRLLDLIPDLEFREVFICGSVGMAAAAVRNLRRAGVR
FT                   RGRIHTEIFDF"
     gtggtccagg gttggtcagc ggggttcgaa gtgccgtacg accccgactg ggtcgtgccg        60
     cggcgggact ggcggcacag cctgcccctg ctgccgcgcc ggccgttgtc ggccgtgttg       120
     ttggccgtgc tcgcggcggg gatcgcgggc ctgttggcgt tgtggtggca ggagacgccc       180
     gccgaccgga tgcagtcgct gcccgactac ctggtgatgc tggcgcagat caccgggctg       240
     gtcggcgcct acctgctgct ggtcgagatc gcgctcatgg cccgcttgcc ctggctggag       300
     caccggctgg gctcgtggct ggcctcggcg caccgcagcc tcggcggcta tctggtgctg       360
     ctgctgtgcg cgcacgtcgg gttcgtgatc gcggcgtact cggtcagcgt gcacgactcg       420
     ccgccggccg ttctcgtcag catcctgcga acctatcccg gggtcctcgc cgcgacgatc       480
     gggttcctgg tgatgctgct cgcggggttc acgtcggccc ggagcatccg ccggcggctg       540
     ggatacgagg ggtggcacgc gatccacctg ctgatgtatc cggcggcggc cgccgcgttc       600
     tggcaccaga tcaccctcgg cgcgcagttc acgcggaacc cgtgggcggc ggacgtgtgg       660
     gtcgggctgc acgcggtcgt cggggcggcg atcgtctgca accgcatagt gatcccgctc       720
     ctgaacaacc ggcaccaccg gttccgcgtg agccgggtcg aggcggtcgg gccggatgcg       780
     atgaacgtct acatcaccgg acggcgggtc gcggacctcg gcgcggaggc cgggcagtac       840
     tttcggtggc ggttcatgca acggagcctg tggtaccagg cgcatccgtt ctccttgtcc       900
     gccgcgccgc acgcggacac gctgcgcctg acgttcaagt gcgtcggcgg atacacccga       960
     cggctcaagc ggcggctgcg accggggagc agggtgttcc tggacggtcc ctacggcgcg      1020
     ttcaccggcg tgctgcgccg ccagcccggc gtggtgatga tcggcggcgg catcggcgtc      1080
     accccgctgc gggcgatcgt ggagacgatg cacaaccggc ggcggaacga catcatcttc      1140
     atccagcgcg cctcgaaggt cggcgacctg atcctcacca acgaactcga agcgctcaac      1200
     gccgtcgggc gcatcatcta catcccggcg atcggcagcc gcaggaacga cccgctgtcc      1260
     gccgaccggc tcctggacct gatccccgac ctggagttcc gcgaggtctt catctgcggc      1320
     tcggtcggca tggccgccgc cgcggtgcgg aacctgcgcc gagccggggt ccgccgggga      1380
     cgcatccata ccgagatctt cgacttctga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page