(data stored in ACNUC7421 zone)

EMBL: CP001700.PE39

CP001700.PE39        Location/Qualifiers
FT   CDS_pept        complement(42621..43256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0039"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   sgr:SGR_3722 putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68994"
FT                   /db_xref="GOA:C7QFQ5"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFQ5"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACU68994.1"
FT                   /translation="MAARILVVDNYDSFVYNLVQYLYQLGAECEVVRNDAIGVEAAHDY
FT                   DGVLLSPGPGTPEEAGVCVAMTGYAEQHRIPVFGVCLGLQSIAVAHGAVVGRAPELLHG
FT                   KTSKVTHDGAGVFQGLPDPFTATRYHSLAIEPETLPQDLLVTARTDSGVIMGIRHRELP
FT                   VEAVQFHPESVLTEGGHRMLANWLTVCGDAGAVERSAGLAPVVLSAAN"
     atggcagcgc ggatcctcgt cgtcgacaac tacgacagct tcgtctacaa cctcgtccag        60
     tacctgtacc agctcggcgc ggagtgcgag gtggtgcgca acgacgcgat cggcgtcgag       120
     gcggcgcacg actacgacgg cgtcctgctc tcgcccggac ccggaacgcc cgaggaagcc       180
     ggcgtctgcg tggcgatgac cggctacgcc gagcagcacc ggatcccggt cttcggcgtc       240
     tgtctgggcc tgcagtcgat cgccgtcgcg cacggcgccg tggtcggccg ggccccggaa       300
     ctgctgcacg gcaagaccag caaggtcacc cacgacggcg cgggcgtctt ccaaggcctt       360
     ccggacccgt tcacggccac gcgctaccac tcgctggcca tagagcccga gacgctgccc       420
     caggacctcc tggtcaccgc gcgcaccgac tcgggcgtca tcatgggcat ccgccaccgt       480
     gaactccccg tcgaggcggt gcagttccac ccggagtccg tcctcacgga gggcggccac       540
     cggatgctgg cgaactggct gacggtgtgc ggcgatgccg gagcggtcga gcggtccgcc       600
     ggactcgctc cggtggttct aagcgcagcc aattga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page